9DK8: TRIF TIR Filament Cryo-EM Structure
TRIF TIR Filament Cryo-EM Structure. Determined by electron microscopy at 3.3 Å resolution. Released 22 Jan 2025.
- Method
- Electron microscopy
- Resolution
- 3.3 Å
- Organism
- Homo sapiens
- Chains
- 6
- Atoms
- 6,678
- Mol. weight
- 351.19 kDa
- Released
- 22 Jan 2025
Explore 9DK8 in 3D
Show helices and sheets
RCSB PDB
PDBe
Secondary structure: helices and β-sheets
9DK8 contains 45 α-helices and 29 β-strands across 6 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
Chain A: 7 helices, 5 β-strands
| Element | Residues | Length | Sheet |
|---|
| β-strand | 395-400 | 6 | 5 |
| α-helix | 406-419 | 14 | |
| β-strand | 424 | 1 | 5 |
| α-helix | 427-429 | 3 | |
| α-helix | 438-447 | 10 | |
| β-strand | 449-455 | 7 | 5 |
| α-helix | 463-478 | 16 | |
| β-strand | 486-490 | 5 | 5 |
| α-helix | 501-504 | 4 | |
| α-helix | 511-512 | 2 | |
| β-strand | 513-514 | 2 | 5 |
| α-helix | 520-527 | 8 | |
Chain B: 7 helices, 5 β-strands
| Element | Residues | Length | Sheet |
|---|
| β-strand | 395-400 | 6 | 2 |
| α-helix | 406-418 | 13 | |
| β-strand | 424 | 1 | 2 |
| α-helix | 427-430 | 4 | |
| α-helix | 439-447 | 9 | |
| β-strand | 449-455 | 7 | 2 |
| α-helix | 463-478 | 16 | |
| β-strand | 486-490 | 5 | 2 |
| α-helix | 496-498 | 3 | |
| α-helix | 501-506 | 6 | |
| β-strand | 513-514 | 2 | 2 |
| α-helix | 520-527 | 8 | |
Chain C: 7 helices, 4 β-strands
| Element | Residues | Length | Sheet |
|---|
| β-strand | 395-400 | 6 | 6 |
| α-helix | 406-418 | 13 | |
| α-helix | 442-447 | 6 | |
| β-strand | 449-455 | 7 | 6 |
| α-helix | 458-461 | 4 | |
| α-helix | 463-478 | 16 | |
| β-strand | 487-490 | 4 | 6 |
| α-helix | 496-498 | 3 | |
| α-helix | 501-504 | 4 | |
| β-strand | 513-514 | 2 | 6 |
| α-helix | 520-527 | 8 | |
Chain D: 9 helices, 5 β-strands
| Element | Residues | Length | Sheet |
|---|
| β-strand | 395-400 | 6 | 4 |
| α-helix | 406-418 | 13 | |
| β-strand | 424 | 1 | 4 |
| α-helix | 427-429 | 3 | |
| α-helix | 441-447 | 7 | |
| β-strand | 449-455 | 7 | 4 |
| α-helix | 458-461 | 4 | |
| α-helix | 463-478 | 16 | |
| β-strand | 486-490 | 5 | 4 |
| α-helix | 496-498 | 3 | |
| α-helix | 501-504 | 4 | |
| α-helix | 505-509 | 5 | |
| β-strand | 513-514 | 2 | 4 |
| α-helix | 520-527 | 8 | |
Chain E: 7 helices, 5 β-strands
| Element | Residues | Length | Sheet |
|---|
| β-strand | 395-400 | 6 | 1 |
| α-helix | 406-419 | 14 | |
| β-strand | 424 | 1 | 1 |
| α-helix | 440-447 | 8 | |
| β-strand | 449-455 | 7 | 1 |
| α-helix | 458-461 | 4 | |
| α-helix | 463-478 | 16 | |
| β-strand | 486-490 | 5 | 1 |
| α-helix | 496-498 | 3 | |
| α-helix | 504-507 | 4 | |
| β-strand | 513-514 | 2 | 1 |
| α-helix | 520-527 | 8 | |
Chain F: 8 helices, 5 β-strands
| Element | Residues | Length | Sheet |
|---|
| β-strand | 395-400 | 6 | 3 |
| α-helix | 406-418 | 13 | |
| β-strand | 424 | 1 | 3 |
| α-helix | 443-447 | 5 | |
| β-strand | 449-455 | 7 | 3 |
| α-helix | 458-461 | 4 | |
| α-helix | 463-478 | 16 | |
| β-strand | 486-490 | 5 | 3 |
| α-helix | 496-498 | 3 | |
| α-helix | 501-504 | 4 | |
| α-helix | 505-507 | 3 | |
| β-strand | 513-514 | 2 | 3 |
| α-helix | 520-527 | 8 | |
Molecules and chains
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|
| TIR domain-containing adapter molecule 1 | A, B, C, D, E, F | protein | 545 | Homo sapiens | Q8IUC6 (AlphaFold model) |
Sequence of entity 1 (A, B, C, D, E, F), FASTA
>9DK8_1 TIR domain-containing adapter molecule 1 (chains A, B, C, D, E, F)
MACTGPSLPSAFDILGAAGQDKLLYLKHKLKTPRPGCQGQDLLHAMVLLKLGQETEARIS
LEALKADAVARLVARQWAGVDSTEDPEEPPDVSWAVARLYHLLAEEKLCPASLRDVAYQE
AVRTLSSRDDHRLGELQDEARNRCGWDIAGDPGSIRTLQSNLGCLPPSSALPSGTRSLPR
PIDGVSDWSQGCSLRSTGSPASLASNLEISQSPTMPFLSLHRSPHGPSKLCDDPQASLVP
EPVPGGCQEPEEMSWPPSGEIASPPELPSSPPPGLPEVAPDATSTGLPDTPAAPETSTNY
PVECTEGSAGPQSLPLPILEPVKNPCSVKDQTPLQLSVEDTTSPNTKPCPPTPTTPETSP
PPPPPPPSSTPCSAHLTPSSLFPSSLESSSEQKFYNFVILHARADEHIALRVREKLEALG
VPDGATFCEDFQVPGRGELSCLQDAIDHSAFIILLLTSNFDCRLSLHQVNQAMMSNLTRQ
GSPDCVIPFLPLESSPAQLSSDTASLLSGLVRLDEHSQIFARKVANTFKPHRLQARKAMW
RKEQD
Primary citation
Structural basis for TIR domain-mediated innate immune signaling by Toll-like receptor adaptors TRIF and TRAM. Manik, M.K., Pan, M., Xiao, L. et al. Proc Natl Acad Sci U S A (2025) 122:e2418988122-e2418988122. DOI 10.1073/pnas.2418988122 · PubMed
Other PDB entries of the same protein (UniProt Q8IUC6 (AlphaFold model), which also has an AlphaFold model), best resolution first:
- 3RC4 1.5 Å, Molecular mechanisms of viral and host-cell substrate recognition by HCV NS3/4A protease
- 5JEL 1.6 Å, Phosphorylated TRIF in complex with IRF-3
- 4BSX 2.23 Å, Crystal Structure of the N terminal domain of TRIF (TIR-domain- containing…
- 4C0M 2.8 Å, Crystal Structure of the N terminal domain of wild type TRIF (TIR- domain-containing…
- 8RLM 3.5 Å, TRIF Oligomerisation
- 2M1X TICAM-1 TIR domain structure
- 2M63 The protease-resistant N-terminal domain of TIR-domain containing adaptor molecule-1,…
Browse structure collections
About this viewer
MolViewer shows 9DK8 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.