The structure of human vacuolar protein sorting 34 catalytic domain bound to RD-I-53. Determined by X-ray diffraction at 2.16 Å resolution. Released 17 Sept 2025.
Explore 9DKP in 3D Show helices and sheets RCSB PDB PDBe
9DKP contains 34 α-helices and 12 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 293-300 | 8 | |
| α-helix | 306-309 | 4 | |
| α-helix | 310-318 | 9 | |
| α-helix | 320-322 | 3 | |
| α-helix | 327-329 | 3 | |
| α-helix | 330-335 | 6 | |
| α-helix | 342-354 | 13 | |
| α-helix | 356-359 | 4 | |
| α-helix | 360-363 | 4 | |
| α-helix | 364-367 | 4 | |
| α-helix | 374-384 | 11 | |
| α-helix | 389-402 | 14 | |
| α-helix | 403-405 | 3 | |
| α-helix | 408-413 | 6 | |
| α-helix | 475-484 | 10 | |
| α-helix | 487-502 | 16 | |
| α-helix | 504-509 | 6 | |
| α-helix | 511-529 | 19 | |
| α-helix | 533-559 | 27 | |
| α-helix | 566-578 | 13 | |
| β-strand | 591-593 | 3 | 1 |
| β-strand | 596-604 | 9 | 1 |
| α-helix | 606-608 | 3 | |
| β-strand | 610-611 | 2 | 1 |
| α-helix | 618 | 1 | |
| β-strand | 619-625 | 7 | 1 |
| β-strand | 630-637 | 8 | 1 |
| α-helix | 642-660 | 19 | |
| β-strand | 672-674 | 3 | 1 |
| β-strand | 679-683 | 5 | 1 |
| β-strand | 688-689 | 2 | 2 |
| α-helix | 690-697 | 8 | |
| α-helix | 700-707 | 8 | |
| β-strand | 709 | 1 | 3 |
| α-helix | 714-716 | 3 | |
| β-strand | 717 | 1 | 3 |
| α-helix | 719-738 | 20 | |
| β-strand | 749-751 | 3 | 2 |
| β-strand | 757-759 | 3 | 2 |
| α-helix | 781-786 | 6 | |
| α-helix | 793-811 | 19 | |
| α-helix | 813-821 | 9 | |
| α-helix | 829-832 | 4 | |
| α-helix | 835-837 | 3 | |
| α-helix | 838-846 | 9 | |
| α-helix | 852-870 | 19 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Phosphatidylinositol 3-kinase catalytic subunit type 3 | B | protein | 594 | Homo sapiens | Q8NEB9 (AlphaFold model) |
>9DKP_1 Phosphatidylinositol 3-kinase catalytic subunit type 3 (chains B) MGHHHHHHHHHHAATRDQLNIIVSYPPTKQLTYEEQDLVWKFRYYLTNQEKALTKFLKCV NWDLPQEAKQALELLGKWKPMDVEDSLELLSSHYTNPTVRRYAVARLRQADDEDLLMYLL QLVQALKYENFDDIKNGLEPTKKDSQSSVSENVSNSGINSAEIDSSQIITSPLPSVSSPP PASKTKEVPDGENLEQDLCTFLISRACKNSTLANYLYWYVIVECEDQDTQQRDPKTHEMY LNVMRRFSQALLKGDKSVRVMRSLLAAQQTFVDRLVHLMKAVQRESGNRKKKNERLQALL GDNEKMNLSDVELIPLPLEPQVKIRGIIPETATLFKSALMPAQLFFKTEDGGKYPVIFKH GDDLRQDQLILQIISLMDKLLRKENLDLKLTPYKVLATSTKHGFMQFIQSVPVAEVLDTE GSIQNFFRKYAPSENGPNGISAEVMDTYVKSCAGYCVITYILGVGDRHLDNLLLTKTGKL FHIDFGYILGRDPKPLPPPMKLNKEMVEGMGGTQSEQYQEFRKQCYTAFLHLRRYSNLIL NLFSLMVDANIPDIALEPDKTVKKVQDKFRLDLSDEEAVHYMQSLIDESVHALF
| ID | Name | Formula | Copies |
|---|---|---|---|
| ETZ | diethyl ether | C4 H10 O | 2 |
| A1A6F | (8R)-3-(1,3-benzothiazol-2-yl)pyrazolo[1,5-a]pyrimidine | C13 H8 N4 S | 1 |
| ETX | 2-ethoxyethanol | C4 H10 O2 | 1 |
Water and common crystallization additives (DMS, K, CL) are not listed.
Facile Bacterial Production of Human Vacuolar Protein Sorting 34 Enables Structural Characterization of Novel Inhibitors. Abiodun, W.O., Dass, R., Tsubaki, E. et al. To be published.
Other PDB entries of the same protein (UniProt Q8NEB9 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 9DKP directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.