9DRX: Gamma-aminobutyric acid receptor subunit beta-2

Human GABAA receptor of beta2-alpha1-beta2-alpha1-gamma2 subtype in complex with GABA plus Lamotrigine. Determined by electron microscopy at 2.95 Å resolution. Released 22 Jan 2025.

Method: Electron microscopy
Resolution: 2.95 Å
Organisms: Homo sapiens, Mus musculus
Chains: 9
Atoms: 17,398
Mol. weight: 364.74 kDa
Ligands: IYJ, ABU, NAG
Released: 22 Jan 2025

Explore 9DRX in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

9DRX contains 69 α-helices and 122 β-strands across 9 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 13 helices, 13 β-strands

Element	Residues	Length	Sheet
α-helix	8-20	13
α-helix	28	1
α-helix	35	1
β-strand	36-51	16	1
β-strand	56-68	13	1
β-strand	81-83	3	1
α-helix	85-90	6
β-strand	96-98	3	2
β-strand	101-106	6	1
β-strand	114	1	1
β-strand	116-118	3	1
β-strand	123-135	13	1
β-strand	147-156	10	2
β-strand	164-168	5	1
α-helix	171-174	4
β-strand	175-176	2	1
α-helix	178-180	3
β-strand	186-199	14	2
β-strand	204-216	13	2
α-helix	219-221	3
α-helix	222-226	5
α-helix	227-237	11
α-helix	238-241	4
α-helix	247-269	23
α-helix	280-306	27
α-helix	310-338	29

Chain B: 13 helices, 20 β-strands

Element	Residues	Length	Sheet
α-helix	13-23	11
β-strand	39-43	5	3
β-strand	44-49	6	4
β-strand	50	1	5
α-helix	52	1
β-strand	53-54	2	4
β-strand	59-67	9	4
β-strand	69-71	3	6
α-helix	73-75	3
β-strand	83-86	4	6
α-helix	90-93	4
β-strand	101	1	7
β-strand	104-108	5	4
β-strand	117	1	4
β-strand	119-122	4	6
β-strand	126-128	3	6
β-strand	131-138	8	4
β-strand	150-154	5	7
β-strand	157	1	7
β-strand	167-171	5	3
α-helix	175-177	3
β-strand	179-181	3	4
β-strand	186	1	5
β-strand	191-204	14	7
β-strand	209-221	13	7
α-helix	226	1
α-helix	227-231	5
α-helix	232-242	11
α-helix	243-246	4
α-helix	252-276	25
α-helix	278-279	2
α-helix	285-310	26
α-helix	315-345	31

Chain C: 16 helices, 12 β-strands

Element	Residues	Length	Sheet
α-helix	8-20	13
α-helix	35	1
β-strand	36-51	16	8
β-strand	56-68	13	8
α-helix	70-72	3
β-strand	81	1	8
α-helix	85-90	6
β-strand	96-98	3	9
β-strand	101-106	6	8
β-strand	114-118	5	8
β-strand	123-135	13	8
α-helix	140-142	3
β-strand	147-156	10	9
β-strand	164-168	5	8
α-helix	171-174	4
β-strand	175-176	2	8
α-helix	178-180	3
β-strand	186-199	14	9
β-strand	204-216	13	9
α-helix	217-218	2
α-helix	220-221	2
α-helix	222-226	5
α-helix	227-236	10
α-helix	238-241	4
α-helix	247-269	23
α-helix	278-279	2
α-helix	280-304	25
α-helix	310-338	29

Chain D: 11 helices, 15 β-strands

Element	Residues	Length	Sheet
α-helix	13-23	11
α-helix	31	1
β-strand	39-44	6	10
β-strand	46-54	9	10
β-strand	59-71	13	10
α-helix	73-75	3
β-strand	83-86	4	10
β-strand	99-101	3	11
β-strand	104	1	10
β-strand	108	1	10
β-strand	117-122	6	10
β-strand	126-138	13	10
β-strand	150-159	10	11
β-strand	167-171	5	10
α-helix	175-177	3
β-strand	180-181	2	10
β-strand	186	1	10
β-strand	191-205	15	11
β-strand	208-221	14	11
α-helix	224-226	3
α-helix	227-231	5
α-helix	232-242	11
α-helix	252-276	25
α-helix	278-279	2
α-helix	285-310	26
α-helix	315-345	31

Chain E: 12 helices, 13 β-strands

Element	Residues	Length	Sheet
α-helix	27-35	9
β-strand	51-66	16	12
β-strand	71-83	13	12
α-helix	85-87	3
β-strand	95-98	4	12
α-helix	100-102	3
β-strand	111-112	2	13
β-strand	116-121	6	12
β-strand	129-134	6	12
β-strand	138-150	13	12
β-strand	162-165	4	14
β-strand	169	1	14
β-strand	170-171	2	13
β-strand	179-190	12	12
β-strand	201-215	15	14
β-strand	218-231	14	14
α-helix	232-233	2
α-helix	235-236	2
α-helix	237-241	5
α-helix	242-256	15
α-helix	262-286	25
α-helix	293-294	2
α-helix	295-323	29
α-helix	325-329	5
α-helix	331-356	26

Chain I: 1 helix, 13 β-strands

Element	Residues	Length	Sheet
α-helix	2-3	2
β-strand	4-7	4	15
β-strand	10-12	3	16
β-strand	19-20	2	17
β-strand	22-25	4	15
β-strand	34-38	5	18
β-strand	44-49	6	18
β-strand	53-54	2	18
β-strand	63-65	3	17
β-strand	70-71	2	15
β-strand	72-75	4	17
β-strand	85-90	6	18
β-strand	96-97	2	18
β-strand	102-104	3	16

Chain J: 1 helix, 11 β-strands

Element	Residues	Length	Sheet
β-strand	3-6	4	19
β-strand	10-12	3	20
β-strand	17-25	9	19
β-strand	34-39	6	20
β-strand	45-51	7	20
β-strand	58-60	3	20
β-strand	68-73	6	19
β-strand	78-84	7	19
α-helix	88-90	3
β-strand	92-98	7	20
β-strand	107-108	2	20
β-strand	112-116	5	20

Chain K: 1 helix, 12 β-strands

Element	Residues	Length	Sheet
β-strand	3-6	4	24
β-strand	10-12	3	25
β-strand	18-25	8	24
α-helix	29-31	3
β-strand	34-39	6	26
β-strand	45-51	7	26
β-strand	58-60	3	26
β-strand	68-73	6	24
β-strand	78-83	6	24
β-strand	93-98	6	26
β-strand	107-108	2	26
β-strand	112-113	2	26
β-strand	114-116	3	25

1 more chain groups are not listed. Open the entry in the viewer and use the sequence panel to see them.

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Gamma-aminobutyric acid receptor subunit beta-2	A, C	protein	364	Homo sapiens	P47870 (AlphaFold model)
Gamma-aminobutyric acid receptor subunit alpha-1	B, D	protein	358	Homo sapiens	P14867 (AlphaFold model)
Gamma-aminobutyric acid receptor subunit gamma-2	E	protein	417	Homo sapiens	P18507 (AlphaFold model)
Kappa Fab 1F4 Light Chain	I, L	protein	213	Mus musculus
IgG2b Fab 1F4 Heavy Chain	J, K	protein	454	Mus musculus

Sequence of entity 1 (A, C), FASTA

>9DRX_1 Gamma-aminobutyric acid receptor subunit beta-2 (chains A, C)
QSVNDPSNMSLVKETVDRLLKGYDIRLRPDFGGPPVAVGMNIDIASIDMVSEVNMDYTLT
MYFQQAWRDKRLSYNVIPLNLTLDNRVADQLWVPDTYFLNDKKSFVHGVTVKNRMIRLHP
DGTVLYGLRITTTAACMMDLRRYPLDEQNCTLEIESYGYTTDDIEFYWRGDDNAVTGVTK
IELPQFSIVDYKLITKKVVFSTGSYPRLSLSFKLKRNIGYFILQTYMPSILITILSWVSF
WINYDASAARVALGITTVLTMTTINTHLRETLPKIPYVKAIDMYLMGCFVFVFMALLEYA
LVNYIFFSQPARAAAIDRWSRIFFPVVFSFFNIVYWLYYVNVDGSGATNFSLLKQAGDVE
ENPG

Sequence of entity 2 (B, D), FASTA

>9DRX_2 Gamma-aminobutyric acid receptor subunit alpha-1 (chains B, D)
QPSLQDELKDNTTVFTRILDRLLDGYDNRLRPGLGERVTEVKTDIFVTSFGPVSDHDMEY
TIDVFFRQSWKDERLKFKGPMTVLRLNNLMASKIWTPDTFFHNGKKSVAHNMTMPNKLLR
ITEDGTLLYTMRLTVRAECPMHLEDFPMDAHACPLKFGSYAYTRAEVVYEWTREPARSVV
VAEDGSRLNQYDLLGQTVDSGIVQSSTGEYVVMTTHFHLKRKIGYFVIQTYLPCIMTVIL
SQVSFWLNRESVPARTVFGVTTVLTMTTLSISARNSLPKVAYATAMDWFIAVCYAFVFSA
LIEFATVNYFTKSQPARAAKIDRLSRIAFPLLFGIFNLVYWATYLNREPQLKAPTPHQ

Sequence of entity 3 (E), FASTA

>9DRX_3 Gamma-aminobutyric acid receptor subunit gamma-2 (chains E)
WSHPQFEKGGGSGGGSGGSSAWSHPQFEKLEVLFQGPQKSDDDYEDYASNKTWVLTPKVP
EGDVTVILNNLLEGYDNKLRPDIGVKPTLIHTDMYVNSIGPVNAINMEYTIDIFFAQTWY
DRRLKFNSTIKVLRLNSNMVGKIWIPDTFFRNSKKADAHWITTPNRMLRIWNDGRVLYTL
RLTIDAECQLQLHNFPMDEHSCPLEFSSYGYPREEIVYQWKRSSVEVGDTRSWRLYQFSF
VGLRNTTEVVKTTSGDYVVMSVYFDLSRRMGYFTIQTYIPCTLIVVLSWVSFWINKDAVP
ARTSLGITTVLTMTTLSTIARKSLPKVSYVTAMDLFVSVCFIFVFSALVEYGTLHYFVSS
QPARAAKMDSYARIFFPTAFCLFNLVYWVSYLYLSRGSGATNFSLLKQAGDVEENPG

Sequence of entity 4 (I, L), FASTA

>9DRX_4 Kappa Fab 1F4 Light Chain (chains I, L)
NIVMTQSPKSMSMSVGERVTLSCKASEYVGTYVSWYQQKPEQSPKLLIYGASNRYTGVPD
RFTGSGSATDFTLTIGSVQAEDLADYHCGQSYSYPTFGAGTKLELKRADAAPTVSIFPPS
SEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTL
TKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC

Sequence of entity 5 (J, K), FASTA

>9DRX_5 IgG2b Fab 1F4 Heavy Chain (chains J, K)
EVQLQQSGAELVKPGASVKLSCTASGFNIKDTYMYWVKQRPEQGLEWIGRIDPANGDTKY
DPKFQGKATITTDTFSNTAYLQLSSLTSEDTAVYYCARKGLRWAMDYWGQGTSVTVSTAK
TTPPSVYPLAPGCGDTTGSSVTLGCLVKGYFPESVTVTWNSGSLSSSVHTFPALLQSGLY
TMSSSVTVPSSTWPSQTVTCSVAHPASSTTVDKKLEPSGPISTINPCPPCKECHKCPAPN
LEGGPSVFIFPPNIKDVLMISLTPKVTCVVVDVSEDDPDVQISWFVNNVEVHTAQTQTHR
EDYNSTIRVVSTLPIQHQDWMSGKEFKCKVNNKDLPSPIERTISKIKGLVRAPQVYILPP
PAEQLSRKDVSLTCLVVGFNPGDISVEWTSNGHTEENYKDTAPVLDSDGSYFIYSKLNMK
TSKWEKTDSFSCNVRHEGLKNYYLKKTISRSPGK

Ligands and cofactors

ID	Name	Formula	Copies
IYJ	(6M)-6-(2,3-dichlorophenyl)-1,2,4-triazine-3,5-diamine	C9 H7 Cl2 N5	1
ABU	Gamma-amino-butanoic acid	C4 H9 N O2	2
NAG	2-acetamido-2-deoxy-beta-D-glucopyranose	C8 H15 N O6	2

Primary citation

Resolving native GABA A receptor structures from the human brain. Zhou, J., Noviello, C.M., Teng, J. et al. Nature (2025) 638:562-568. DOI 10.1038/s41586-024-08454-1 · PubMed

Other PDB entries of the same protein (UniProt P47870 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6X3T 2.55 Å, Human GABAA receptor alpha1-beta2-gamma2 subtype in complex with GABA plus propofol
8VRN 2.57 Å, Human GABAA receptor alpha1-beta2-gamma2 subtype in complex with GABA plus PPTQ
8SGO 2.65 Å, Human GABAA receptor alpha1-beta2-gamma2 subtype in complex with GABA plus pregnenolone…
8SID 2.71 Å, Human GABAA receptor alpha1-beta2-gamma2 subtype in complex with GABA plus…
8VQY 2.82 Å, Human GABAA receptor alpha1-beta2-gamma2 subtype in complex with GABA plus methaqualone
6X40 2.86 Å, Human GABAA receptor alpha1-beta2-gamma2 subtype in complex with GABA plus picrotoxin
8DD2 2.9 Å, Human GABAA receptor alpha1-beta2-gamma2 subtype in complex with GABA plus Zolpidem
8DD3 2.9 Å, Human GABAA receptor alpha1-beta2-gamma2 subtype in complex with GABA plus DMCM
9CRS 2.9 Å, Native human GABAA receptor of beta2-alpha1-beta2-alpha1-gamma2 assembly
6X3X 2.92 Å, Human GABAA receptor alpha1-beta2-gamma2 subtype in complex with GABA plus diazepam
8SI9 2.98 Å, Human GABAA receptor alpha1-beta2-gamma2 subtype in complex with GABA plus…
7T0W 3.0 Å, Complex of GABA-A synaptic receptor with autoimmune antibody Fab115

Browse structure collections

About this viewer

MolViewer shows 9DRX directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.