9E3G: Acetylcholine receptor subunit alpha

Torpedo muscle-type nicotinic acetylcholine receptor - Monoliganded State. Determined by electron microscopy at 3.13 Å resolution. Released 8 Oct 2025.

Method: Electron microscopy
Resolution: 3.13 Å
Organism: Tetronarce californica
Chains: 5
Atoms: 16,980
Mol. weight: 278.55 kDa
Ligands: POV, ACH
Released: 8 Oct 2025

Explore 9E3G in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

9E3G contains 78 α-helices and 90 β-strands across 5 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 15 helices, 14 β-strands

Element	Residues	Length	Sheet
α-helix	2-11	10
β-strand	29-44	16	1
β-strand	49-61	13	1
α-helix	63-65	3
α-helix	69-72	4
β-strand	77-80	4	1
α-helix	82-84	3
β-strand	90-92	3	2
β-strand	95	1	1
β-strand	108-111	4	1
β-strand	115-118	4	1
β-strand	121-127	7	1
β-strand	139-148	10	2
β-strand	156-160	5	1
β-strand	166	1	1
β-strand	176-188	13	2
β-strand	198-209	12	2
α-helix	212-214	3
α-helix	215-219	5
α-helix	220-229	10
α-helix	232-234	3
α-helix	237-239	3
α-helix	242-260	19
α-helix	273-299	27
α-helix	310-313	4
α-helix	314-319	6
α-helix	320-323	4
β-strand	329	1	3
α-helix	370-433	64

Chain B: 16 helices, 23 β-strands

Element	Residues	Length	Sheet
α-helix	3-11	9
β-strand	29-34	6	4
β-strand	36	1	5
β-strand	37-44	8	6
β-strand	49-55	7	6
β-strand	57-61	5	4
β-strand	77-80	4	4
β-strand	90-92	3	7
β-strand	95	1	6
α-helix	106-107	2
β-strand	108-111	4	4
β-strand	115-118	4	4
β-strand	121-127	7	6
β-strand	139-148	10	7
β-strand	156-160	5	4
β-strand	162	1	8
β-strand	169	1	8
β-strand	172	1	9
β-strand	174	1	5
α-helix	180	1
β-strand	181	1	6
α-helix	182-183	2
β-strand	186-190	5	7
β-strand	192	1	9
β-strand	193-194	2	7
β-strand	207-215	9	7
α-helix	218-220	3
α-helix	221-225	5
α-helix	226-237	12
α-helix	243-245	3
α-helix	248-265	18
α-helix	266-268	3
α-helix	279-306	28
β-strand	312	1	3
α-helix	316-319	4
α-helix	320-324	5
α-helix	326-329	4
α-helix	401-459	59
α-helix	462-464	3

Chain C: 15 helices, 22 β-strands

Element	Residues	Length	Sheet
α-helix	4-9	6
α-helix	10-14	5
β-strand	31-36	6	10
β-strand	38	1	11
β-strand	39-46	8	12
β-strand	51-57	7	12
β-strand	59-63	5	10
α-helix	72-74	3
β-strand	80-82	3	10
α-helix	84-86	3
β-strand	92-94	3	13
α-helix	108-109	2
β-strand	110-112	3	10
β-strand	117-120	4	10
β-strand	123-129	7	12
β-strand	141	1	14
β-strand	144-150	7	13
β-strand	158-162	5	10
β-strand	164-167	4	15
β-strand	170-173	4	15
β-strand	176	1	16
β-strand	178	1	11
β-strand	190-194	5	14
β-strand	196	1	16
β-strand	197-201	5	13
β-strand	213-219	7	13
β-strand	220-223	4	14
α-helix	226-228	3
α-helix	229-233	5
α-helix	234-245	12
α-helix	246-248	3
α-helix	256-274	19
α-helix	287-313	27
α-helix	324-328	5
α-helix	329-333	5
α-helix	334-337	4
α-helix	419-478	60

Chain D: 15 helices, 13 β-strands

Element	Residues	Length	Sheet
α-helix	2-11	10
β-strand	29-44	16	17
β-strand	49-61	13	17
α-helix	69-72	4
β-strand	77-81	5	17
α-helix	82-84	3
β-strand	90-92	3	18
β-strand	95	1	17
β-strand	107-111	5	17
β-strand	115-118	4	17
β-strand	121-127	7	17
β-strand	139-148	10	18
β-strand	156-160	5	17
β-strand	166	1	17
α-helix	170-173	4
β-strand	176-188	13	18
β-strand	198-209	12	18
α-helix	212-214	3
α-helix	215-219	5
α-helix	220-230	11
α-helix	242-263	22
α-helix	273-299	27
α-helix	310-313	4
α-helix	314-319	6
α-helix	320-322	3
α-helix	377-422	46
α-helix	423-427	5
α-helix	428-434	7

Chain E: 17 helices, 18 β-strands

Element	Residues	Length	Sheet
α-helix	3-11	9
β-strand	29-44	16	19
β-strand	49-61	13	19
α-helix	69-72	4
β-strand	77-80	4	19
α-helix	82-84	3
β-strand	90-92	3	20
β-strand	95	1	19
α-helix	106-107	2
β-strand	108-111	4	19
β-strand	115-118	4	19
β-strand	121-127	7	19
α-helix	132-134	3
β-strand	139-148	10	20
β-strand	156-160	5	19
β-strand	162	1	21
β-strand	167	1	21
β-strand	170	1	22
β-strand	172	1	19
α-helix	175-177	3
β-strand	184-188	5	20
β-strand	190	1	22
β-strand	191-195	5	20
α-helix	204-206	3
β-strand	207-217	11	20
α-helix	220-222	3
α-helix	223-227	5
α-helix	228-234	7
α-helix	235-237	3
α-helix	239-242	4
α-helix	251-269	19
α-helix	282-308	27
α-helix	319-326	8
α-helix	418-471	54
α-helix	474-476	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Acetylcholine receptor subunit alpha	A, D	protein	437	Tetronarce californica	P02710 (AlphaFold model)
Acetylcholine receptor subunit beta	B	protein	469	Tetronarce californica	P02712 (AlphaFold model)
Acetylcholine receptor subunit delta	C	protein	501	Tetronarce californica	P02718 (AlphaFold model)
Acetylcholine receptor subunit gamma	E	protein	488	Tetronarce californica	P02714 (AlphaFold model)

Sequence of entity 1 (A, D), FASTA

>9E3G_1 Acetylcholine receptor subunit alpha (chains A, D)
SEHETRLVANLLENYNKVIRPVEHHTHFVDITVGLQLIQLISVDEVNQIVETNVRLRQQW
IDVRLRWNPADYGGIKKIRLPSDDVWLPDLVLYNNADGDFAIVHMTKLLLDYTGKIMWTP
PAIFKSYCEIIVTHFPFDQQNCTMKLGIWTYDGTKVSISPESDRPDLSTFMESGEWVMKD
YRGWKHWVYYTCCPDTPYLDITYHFIMQRIPLYFVVNVIIPCLLFSFLTGLVFYLPTDSG
EKMTLSISVLLSLTVFLLVIVELIPSTSSAVPLIGKYMLFTMIFVISSIIITVVVINTHH
RSPSTHTMPQWVRKIFIDTIPNVMFFSTMKRASKEKQENKIFADDIDISDISGKQVTGEV
IFQTPLIKNPDVKSAIEGVKYIAEHMKSDEESSNAAEEWKYVAMVIDHILLCVFMLICII
GTVSVFAGRLIELSQEG

Sequence of entity 2 (B), FASTA

>9E3G_2 Acetylcholine receptor subunit beta (chains B)
SVMEDTLLSVLFETYNPKVRPAQTVGDKVTVRVGLTLTNLLILNEKIEEMTTNVFLNLAW
TDYRLQWDPAAYEGIKDLRIPSSDVWQPDIVLMNNNDGSFEITLHVNVLVQHTGAVSWQP
SAIYRSSCTIKVMYFPFDWQNCTMVFKSYTYDTSEVTLQHALDAKGEREVKEIVINKDAF
TENGQWSIEHKPSRKNWRSDDPSYEDVTFYLIIQRKPLFYIVYTIIPCILISILAILVFY
LPPDAGEKMSLSISALLAVTVFLLLLADKVPETSLSVPIIIRYLMFIMILVAFSVILSVV
VLNLHHRSPNTHTMPNWIRQIFIETLPPFLWIQRPVTTPSPDSKPTIISRANDEYFIRKP
AGDFVCPVDNARVAVQPERLFSEMKWHLNGLTQPVTLPQDLKEAVEAIKYIAEQLESASE
FDDLKKDWQYVAMVADRLFLYVFFVICSIGTFSIFLDASHNVPPDNPFA

Sequence of entity 3 (C), FASTA

>9E3G_3 Acetylcholine receptor subunit delta (chains C)
VNEEERLINDLLIVNKYNKHVRPVKHNNEVVNIALSLTLSNLISLKETDETLTSNVWMDH
AWYDHRLTWNASEYSDISILRLPPELVWIPDIVLQNNNDGQYHVAYFCNVLVRPNGYVTW
LPPAIFRSSCPINVLYFPFDWQNCSLKFTALNYDANEITMDLMTDTIDGKDYPIEWIIID
PEAFTENGEWEIIHKPAKKNIYPDKFPNGTNYQDVTFYLIIRRKPLFYVINFITPCVLIS
FLASLAFYLPAESGEKMSTAISVLLAQAVFLLLTSQRLPETALAVPLIGKYLMFIMSLVT
GVIVNCGIVLNFHFRTPSTHVLSTRVKQIFLEKLPRILHMSRADESEQPDWQNDLKLRRS
SSVGYISKAQEYFNIKSRSELMFEKQSERHGLVPRVTPRIGFGNNNENIAASDQLHDEIK
SGIDSTNYIVKQIKEKNAYDEEVGNWNLVGQTIDRLSMFIITPVMVLGTIFIFVMGNFNH
PPAKPFEGDPFDYSSDHPRCA

Sequence of entity 4 (E), FASTA

>9E3G_4 Acetylcholine receptor subunit gamma (chains E)
NEEGRLIEKLLGDYDKRIIPAKTLDHIIDVTLKLTLTNLISLNEKEEALTTNVWIEIQWN
DYRLSWNTSEYEGIDLVRIPSELLWLPDVVLENNVDGQFEVAYYANVLVYNDGSMYWLPP
AIYRSTCPIAVTYFPFDWQNCSLVFRSQTYNAHEVNLQLSAEEGEAVEWIHIDPEDFTEN
GEWTIRHRPAKKNYNWQLTKDDTDFQEIIFFLIIQRKPLFYIINIIAPCVLISSLVVLVY
FLPAQAGGQKCTLSISVLLAQTIFLFLIAQKVPETSLNVPLIGKYLIFVMFVSMLIVMNC
VIVLNVSLRTPNTHSLSEKIKHLFLGFLPKYLGMQLEPSEETPEKPQPRRRSSFGIMIKA
EEYILKKPRSELMFEEQKDRHGLKRVNKMTSDIDIGTTVDLYKDLANFAPEIKSCVEACN
FIAKSTKEQNDSGSENENWVLIGKVIDKACFWIALLLFSIGTLAIFLTGHFNQVPEFPFP
GDPRKYVP

Ligands and cofactors

ID	Name	Formula	Copies
POV	(2S)-3-(hexadecanoyloxy)-2-[(9Z)-octadec-9-enoyloxy]propyl…	C42 H82 N O8 P	5
ACH	Acetylcholine	C7 H16 N O2	1

Primary citation

Asynchronous subunit transitions prime acetylcholine receptor activation. Thompson, M.J., Tessier, C.J.G., Ananchenko, A. et al. Science (2026) 391:eadw1264-eadw1264. DOI 10.1126/science.adw1264 · PubMed

Other PDB entries of the same protein (UniProt P02710 (AlphaFold model), which also has an AlphaFold model), best resolution first:

8YQN 2.27 Å, Torpedo acetylcholine receptor in complex with Erabutoxin A
7QL5 2.5 Å, Torpedo muscle-type nicotinic acetylcholine receptor - nicotine-bound conformation
7SMM 2.5 Å, Cryo-EM structure of Torpedo acetylcholine receptor in apo form
7SMT 2.56 Å, Cryo-EM structure of Torpedo acetylcholine receptor in complex with d-tubocurarine and…
6UWZ 2.69 Å, Cryo-EM structure of Torpedo acetylcholine receptor in complex with alpha-bungarotoxin
8F6Z 2.7 Å, Cryo-EM structure of Torpedo nicotinic acetylcholine receptor in complex with…
7SMQ 2.74 Å, Cryo-EM structure of Torpedo acetylcholine receptor in apo form with added cholesterol
7SMR 2.77 Å, Cryo-EM structure of Torpedo acetylcholine receptor in complex with carbachol,…
8F6Y 2.79 Å, Cryo-EM structure of Torpedo nicotinic acetylcholine receptor in complex with etomidate,…
9E3E 2.8 Å, Torpedo muscle-type nicotinic acetylcholine receptor - Diliganded State
7QKO 2.9 Å, Torpedo muscle-type nicotinic acetylcholine receptor - Resting conformation
8ESK 2.9 Å, Cryo-EM structure of Torpedo nicotinic acetylcholine receptor in complex with…

Browse structure collections

About this viewer

MolViewer shows 9E3G directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.