9EHA: N-SH2 domain of SHP2

Crystal structure of N-SH2 domain of SHP2 bound to phosphotyrosine. Determined by X-ray diffraction at 1.71 Å resolution. Released 7 Jan 2026.

Method: X-ray diffraction
Resolution: 1.71 Å
Organism: Homo sapiens
Chains: 1
Atoms: 913
Mol. weight: 12.56 kDa
Ligands: PTR
Released: 7 Jan 2026

Explore 9EHA in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

9EHA contains 2 α-helices and 10 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 2 helices, 10 β-strands

Element	Residues	Length	Sheet
β-strand	7	1	1
α-helix	13-23	11
β-strand	28-33	6	1
β-strand	41-47	7	1
β-strand	50-55	6	1
β-strand	57-58	2	2
β-strand	63-64	2	2
β-strand	71	1	2
α-helix	74-83	10
β-strand	89	1	3
β-strand	95	1	3
β-strand	100-101	2	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Isoform 1 of Tyrosine-protein phosphatase non-receptor type 11	A	protein	109	Homo sapiens	Q06124 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>9EHA_1 Isoform 1 of Tyrosine-protein phosphatase non-receptor type 11 (chains A)
GSGMTSRRWFHPNITGVEAENLLLTRGVDGSFLARPSKSNPGDFTLSVRRNGAVTHIKIQ
NTGDYYDLYGGEKFATLAELVQYYMEHHGQLKEKNGDVIELKYPLNCAD

Ligands and cofactors

ID	Name	Formula	Copies
PTR	O-phosphotyrosine	C9 H12 N O6 P	1

Water and common crystallization additives (SO4) are not listed.

Primary citation

Phosphatase SHP2 pathogenic mutations enhance activity by altering conformational sampling. Glaser, A.W., Padua, R.A.P., Ojoawo, A.M. et al. Proc Natl Acad Sci U S A (2026) 123:e2513851123-e2513851123. DOI 10.1073/pnas.2513851123 · PubMed

Other PDB entries of the same protein (UniProt Q06124 (AlphaFold model), which also has an AlphaFold model), best resolution first:

9EIK 1.25 Å, Crystal structure of N-SH2 domain of SHP2 with T42A mutation bound to GAB1 tyrosine…
3ZM1 1.4 Å, Catalytic domain of human SHP2
4JMG 1.4 Å, Crystal structure of the synthetic protein in complex with pY peptide
7PPM 1.48 Å, SHP2 catalytic domain in complex with IRS1 (889-901) phosphopeptide (pSer-892, pTyr-896)
3ZM0 1.5 Å, Catalytic domain of human SHP2
3ZM2 1.5 Å, Catalytic domain of human SHP2
3ZM3 1.5 Å, Catalytic domain of human SHP2
7PPL 1.53 Å, SHP2 catalytic domain in complex with IRS1 (625-639) phosphopeptide (pTyr-632, pSer-636)
9EIC 1.58 Å, Crystal structure of unbound N-SH2 domain of SHP2 with T42A mutation
9EHD 1.59 Å, Crystal structure of N-SH2 domain of SHP2 bound to GAB1 tyrosine phosphorylated peptide…
3B7O 1.6 Å, Crystal structure of the human tyrosine phosphatase SHP2 (PTPN11) with an accessible…
4RDD 1.6 Å, Co-crystal structure of SHP2 in complex with a Cefsulodin derivative

Browse structure collections

About this viewer

MolViewer shows 9EHA directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.