9EUU: Alpha-synuclein

Structure of recombinant alpha-synuclein fibrils 1B capable of seeding GCIs in vivo. Determined by electron microscopy at 1.93 Å resolution. Released 5 Jun 2024.

Method: Electron microscopy
Resolution: 1.93 Å
Organism: Homo sapiens
Chains: 18
Atoms: 7,578
Mol. weight: 260.57 kDa
Released: 5 Jun 2024

Explore 9EUU in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

9EUU contains 0 α-helices and 90 β-strands across 18 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chains A, B, C, D, E, F, G, H, I, J, K, L, M, N, O, P, Q and R: 0 helices, 5 β-strands

Element	Residues	Length	Sheet
β-strand	38-40	3	1
β-strand	43-65	23	2
β-strand	69-71	3	3
β-strand	74-83	10	4
β-strand	88-96	9	5

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Alpha-synuclein	A, B, C, D, E, F, G, H, I, J, K, L, M, N, O, P, Q, R	protein	140	Homo sapiens	P37840 (AlphaFold model)

Sequence of entity 1 (A, B, C, D, E, F, G, H, I, J, K, L, M, N, O, P, Q, R), FASTA

>9EUU_1 Alpha-synuclein (chains A, B, C, D, E, F, G, H, I, J, K, L, M, N, O, P, Q, R)
MDVFMKGLSKAKEGVVAAAEKTKQGVAEAAGKTKEGVLYVGSKTKEGVVHGVATVAEKTK
EQVTNVGGAVVTGVTAVAQKTVEGAGSIAAATGFVKKDQLGKNEEGAPQEGILEDMPVDP
DNEAYEMPSEEGYQDYEPEA

Primary citation

Synthetic alpha-synuclein fibrils replicate in mice causing MSA-like pathology. Burger, D., Kashyrina, M., van den Heuvel, L. et al. Nature (2025) 648:409-417. DOI 10.1038/s41586-025-09698-1 · PubMed

Other PDB entries of the same protein (UniProt P37840 (AlphaFold model), which also has an AlphaFold model), best resolution first:

8JJV 1.23 Å, Structure of truncated form of nanobody in complex with alpha-synuclein peptide
8JLY 1.29 Å, Structure of nanobody in complex with alpha-synuclein peptide
3Q27 1.3 Å, Cyrstal structure of human alpha-synuclein (32-57) fused to maltose binding protein (MBP)
4R0U 1.38 Å, Tgvtava, an amyloid forming segment from alpha synuclein, residues 72-78
6I42 1.38 Å, Structure of the alpha-Synuclein PreNAC/Cyclophilin A-complex
4ZNN 1.41 Å, MicroED structure of the segment, GVVHGVTTVA, from the A53T familial mutant of…
4RIL 1.43 Å, Structure of the amyloid forming segment, GAVVTGVTAVA, from the NAC domain of…
4R0W 1.5 Å, Vvtgvta, an amyloid forming segment from alpha synuclein, residues 70-76
3Q26 1.54 Å, Cyrstal structure of human alpha-synuclein (10-42) fused to maltose binding protein (MBP)
3Q28 1.6 Å, Cyrstal structure of human alpha-synuclein (58-79) fused to maltose binding protein (MBP)
5CRW 1.6 Å, Crystal structure of the b'-a' domain of oxidized protein disulfide isomerase complexed…
2X6M 1.62 Å, Structure of a single domain camelid antibody fragment in complex with a C-terminal…

Browse structure collections

About this viewer

MolViewer shows 9EUU directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.