PDZ domain in complex with the peptide from AP2-associated protein kinase 1. Determined by X-ray diffraction at 1.0 Å resolution. Released 14 May 2025.
Explore 9F6S in 3D Show helices and sheets RCSB PDB PDBe
9F6S contains 5 α-helices and 6 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 3-8 | 6 | 1 |
| α-helix | 13 | 1 | |
| β-strand | 16-21 | 6 | 1 |
| α-helix | 22-24 | 3 | |
| β-strand | 26-33 | 8 | 1 |
| α-helix | 38-41 | 4 | |
| α-helix | 48 | 1 | |
| β-strand | 49-53 | 5 | 1 |
| β-strand | 56-57 | 2 | 1 |
| α-helix | 63-71 | 9 | |
| β-strand | 77-82 | 6 | 1 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| PDZ and LIM domain protein 5 | A | protein | 90 | Homo sapiens | Q96HC4 (AlphaFold model) |
| AP2-associated protein kinase 1 | B | protein | 6 | Homo sapiens | Q2M2I8 (AlphaFold model) |
>9F6S_1 PDZ and LIM domain protein 5 (chains A) GPLGSMSNYSVSLVGPAPWGFRLQGGKDFNMPLTISSLKDGGKAAQANVRIGDVVLSIDG INAQGMTHLEAQNKIKGCTGSLNMTLQRAS
>9F6S_2 AP2-associated protein kinase 1 (chains B) DQLIDL
AAK1-mediated phosphorylation of PDLIM5 and Talin1 promotes focal adhesion disassembly to accelerate cell migration. Krocianova, D., Dagg, A.D., Clayton, R.A. et al. Nat Commun (2026). DOI 10.1038/s41467-026-72501-w · PubMed
Other PDB entries of the same protein (UniProt Q96HC4 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 9F6S directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.