9FAU: Human full-length beta3gamma2 GABA(A) receptor

CryoEM structure of human full-length beta3gamma2 GABA(A) receptor in complex with GARLH4, the TMD of Neuroligin2 and Megabody25, in a closed state (StateC1). Determined by electron microscopy at 3.1 Å resolution. Released 2 Jul 2025.

Method: Electron microscopy
Resolution: 3.1 Å
Organisms: Homo sapiens, Lama glama
Chains: 10
Atoms: 19,115
Mol. weight: 455.8 kDa
Ligands: HEX, D10, PGW, PX2
Released: 2 Jul 2025

Explore 9FAU in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

9FAU contains 87 α-helices and 105 β-strands across 10 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 13 helices, 12 β-strands

Element	Residues	Length	Sheet
α-helix	10-20	11
α-helix	35	1
β-strand	36-51	16	6
β-strand	56-68	13	6
α-helix	80	1
β-strand	81-83	3	6
α-helix	87-90	4
β-strand	96-98	3	5
β-strand	101-106	6	6
β-strand	114-118	5	6
β-strand	123-135	13	6
β-strand	147-156	10	5
β-strand	164-168	5	6
α-helix	171-173	3
β-strand	175-176	2	6
α-helix	178-180	3
β-strand	186-199	14	5
β-strand	204-216	13	5
α-helix	219-221	3
α-helix	222-226	5
α-helix	227-236	10
α-helix	237-240	4
α-helix	247-271	25
α-helix	280-305	26
α-helix	422-446	25

Chain B: 13 helices, 12 β-strands

Element	Residues	Length	Sheet
α-helix	10-20	11
α-helix	35	1
β-strand	36-51	16	1
β-strand	56-68	13	1
β-strand	81-83	3	1
α-helix	85-89	5
β-strand	96-98	3	2
β-strand	101-106	6	1
β-strand	114-118	5	1
β-strand	123-135	13	1
α-helix	140-142	3
β-strand	147-156	10	2
β-strand	164-168	5	1
α-helix	171-174	4
β-strand	175-176	2	1
β-strand	186-199	14	2
β-strand	204-216	13	2
α-helix	220-221	2
α-helix	222-226	5
α-helix	227-236	10
α-helix	238-241	4
α-helix	247-268	22
α-helix	280-303	24
α-helix	304-308	5
α-helix	422-446	25

Chain C: 15 helices, 14 β-strands

Element	Residues	Length	Sheet
α-helix	27-35	9
α-helix	43	1
α-helix	50	1
β-strand	51-66	16	10
β-strand	71-83	13	10
β-strand	96-98	3	10
α-helix	100-103	4
β-strand	111-113	3	11
β-strand	116	1	10
β-strand	121	1	10
β-strand	125	1	9
β-strand	129-133	5	10
β-strand	138-150	13	10
α-helix	155-157	3
β-strand	162-171	10	11
β-strand	179-183	5	10
β-strand	189-190	2	10
α-helix	193-195	3
β-strand	201-214	14	11
β-strand	219-231	13	11
α-helix	234-236	3
α-helix	237-241	5
α-helix	242-256	15
α-helix	262-279	18
α-helix	282-285	4
α-helix	295-323	29
α-helix	376-379	4
α-helix	397-399	3
α-helix	402-426	25

Chain D: 16 helices, 14 β-strands

Element	Residues	Length	Sheet
α-helix	10-20	11
α-helix	28	1
α-helix	35	1
β-strand	36-41	6	7
β-strand	42-43	2	8
β-strand	44-51	8	7
β-strand	56-68	13	7
α-helix	70-72	3
α-helix	80	1
β-strand	81-83	3	7
α-helix	87-90	4
β-strand	96-98	3	9
β-strand	101-106	6	7
β-strand	114-118	5	7
β-strand	123-134	12	7
β-strand	147-156	10	9
β-strand	164-168	5	7
α-helix	171-173	3
β-strand	175-176	2	8
β-strand	186-199	14	9
β-strand	204-216	13	9
α-helix	217	1
α-helix	219-221	3
α-helix	222-226	5
α-helix	227-236	10
α-helix	237-241	5
α-helix	247-266	20
α-helix	281-302	22
α-helix	303-307	5
α-helix	422-446	25

Chain E: 16 helices, 13 β-strands

Element	Residues	Length	Sheet
α-helix	10-20	11
α-helix	28	1
α-helix	35	1
β-strand	36-51	16	3
β-strand	56-68	13	3
α-helix	70-72	3
β-strand	81-82	2	3
α-helix	85-90	6
β-strand	96-98	3	4
β-strand	101-106	6	3
β-strand	110	1	5
β-strand	114-118	5	3
β-strand	123-135	13	3
α-helix	140-142	3
β-strand	147-156	10	4
β-strand	164-168	5	3
α-helix	171-173	3
β-strand	176	1	3
α-helix	178-180	3
β-strand	186-199	14	4
β-strand	204-216	13	4
α-helix	219-221	3
α-helix	222-226	5
α-helix	227-237	11
α-helix	238-241	4
α-helix	247-271	25
α-helix	280-302	23
α-helix	303-307	5
α-helix	422-445	24

Chain F: 2 helices, 10 β-strands

Element	Residues	Length	Sheet
β-strand	2-7	6	19
β-strand	405-413	9	19
β-strand	420-426	7	20
α-helix	431-432	2
β-strand	433-438	6	20
β-strand	446-447	2	20
β-strand	455-460	6	19
β-strand	465-470	6	19
β-strand	479-486	8	20
α-helix	496-498	3
β-strand	501-502	2	20
β-strand	506-508	3	20

Chain H: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	673-698	26

Chain K: 1 helix, 13 β-strands

Element	Residues	Length	Sheet
β-strand	2-7	6	14
β-strand	405	1	15
β-strand	408-413	6	14
β-strand	420-426	7	16
β-strand	433-438	6	16
β-strand	446-447	2	16
β-strand	455	1	15
β-strand	458-459	2	14
β-strand	465-467	3	14
β-strand	470	1	15
β-strand	479-486	8	16
α-helix	496-498	3
β-strand	501-502	2	16
β-strand	506-508	3	16

2 more chain groups are not listed. Open the entry in the viewer and use the sequence panel to see them.

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Gamma-aminobutyric acid receptor subunit beta-3	A, B, D, E	protein	439	Homo sapiens	P28472 (AlphaFold model)
Isoform 2 of Gamma-aminobutyric acid receptor subunit gamma-2	C	protein	404	Homo sapiens	P18507 (AlphaFold model)
Neuroligin-2	H	protein	33	Homo sapiens	Q8NFZ4 (AlphaFold model)
LHFPL tetraspan subfamily member 4 protein	L	protein	188	Homo sapiens	Q7Z7J7 (AlphaFold model)
Megabody25	F, K, O	protein	522	Lama glama

Sequence of entity 1 (A, B, D, E), FASTA

>9FAU_1 Gamma-aminobutyric acid receptor subunit beta-3 (chains A, B, D, E)
MSFVKETVDKLLKGYDIRLRPDFGGPPVCVGMNIDIASIDMVSEVNMDYTLTMYFQQYWR
DKRLAYSGIPLNLTLDNRVADQLWVPDTYFLNDKKSFVHGVTVKNRMIRLHPDGTVLYGL
RITTTAACMMDLRRYPLDEQNCTLEIESYGYTTDDIEFYWRGGDKAVTGVERIELPQFSI
VEHRLVSRNVVFATGAYPRLSLSFRLKRNIGYFILQTYMPSILITILSWVSFWINYDASA
ARVALGITTVLTMTTINTHLRETLPKIPYVKAIDMYLMGCFVFVFLALLEYAFVNYIFFG
RGPQRQKKLAEKTAKAKNDRSKSESNRVDAHGNILLTSLEVHNEMNEVSGGIGDTRNSAI
SFDNSGIQYRKQSMPREGHGRFLGDRSLPHKKTHLRRRSSQLKIKIPDLTDVNAIDRWSR
IVFPFTFSLFNLVYWLYYV

Sequence of entity 2 (C), FASTA

>9FAU_2 Isoform 2 of Gamma-aminobutyric acid receptor subunit gamma-2 (chains C)
DVTVILNNLLEGYDNKLRPDIGVKPTLIHTDMYVNSIGPVNAINMEYTIDIFFAQTWYDR
RLKFNSTIKVLRLNSNMVGKIWIPDTFFRNSKKADAHWITTPNRMLRIWNDGRVLYTLRL
TIDAECQLQLHNFPMDEHSCPLEFSSYGYPREEIVYQWKRSSVEVGDTRSWRLYQFSFVG
LRNTTEVVKTTSGDYVVMSVYFDLSRRMGYFTIQTYIPCTLIVVLSWVSFWINKDAVPAR
TSLGITTVLTMTTLSTIARKSLPKVSYVTAMDLFVSVCFIFVFSALVEYGTLHYFVSNRK
PSKDKDKKKKNPAPTIDIRPRSATIQMNNATHLQERDEEYGYECLDGKDCASFFCCFEDC
RTGAWRHGRIHIRIAKMDSYARIFFPTAFCLFNLVYWVSYLYLG

Sequence of entity 3 (H), FASTA

>9FAU_3 Neuroligin-2 (chains H)
DSRDYSTELSVTVAVGASLLFLNILAFAALYYK

Sequence of entity 4 (L), FASTA

>9FAU_4 LHFPL tetraspan subfamily member 4 protein (chains L)
MRNSRAIGVLWAIFTICFAIINVVVFIQPYWVGDSVSTPKPGYFGLFHYCVGSGLAGREL
TCRGSFTDFSTIPSSAFKAAAFFVLLSMVLILGCITCFSLFFFCNTATVYKICAWMQLLA
ALCLVLGCMIFPDGWDAETIRDMCGAKTGKYSLGDCSVRWAYILAIIGILNALILSFLAF
VLGNRQTD

Sequence of entity 5 (F, K, O), FASTA

>9FAU_5 Megabody25 (chains F, K, O)
QVQLVESGGGLVQTKTTTSVIDTTNDAQNLLTQAQTIVNTLKDYCPILIAKSSSSNGGTN
NANTPSWQTAGGGKNSCATFGAEFSAASDMINNAQKIVQETQQLSANQPKNITQPHNLNL
NSPSSLTALAQKMLKNAQSQAEILKLANQVESDFNKLSSGHLKDYIGKCDASAISSANMT
MQNQKNNWGNGCAGVEETQSLLKTSAADFNNQTPQINQAQNLANTLIQELGNNTYEQLSR
LLTNDNGTNSKTSAQAINQAVNNLNERAKTLAGGTTNSPAYQATLLALRSVLGLWNSMGY
AVICGGYTKSPGENNQKDFHYTDENGNGTTINCGGSTNSNGTHSYNGTNTLKADKNVSLS
IEQYEKIHEAYQILSKALKQAGLAPLNSKGEKLEAHVTTSKYGSLRLSCAASGHTFNYPI
MGWFRQAPGKEREFVGAISWSGGSTSYADSVKDRFTISRDNAKNTVYLEMNNLKPEDTAV
YYCAAKGRYSGGLYYPTNYDYWGQGTQVTVSSHHHHHHEPEA

Ligands and cofactors

ID	Name	Formula	Copies
HEX	Hexane	C6 H14	6
D10	Decane	C10 H22	6
PGW	(1R)-2-{[(S)-{[(2S)-2,3-dihydroxypropyl]oxy}(hydroxy)phosphoryl]oxy}-1-[(hexade…	C40 H77 O10 P	2
PX2	1,2-dilauroyl-sn-glycero-3-phosphate	C27 H52 O8 P	1
NAG	2-acetamido-2-deoxy-beta-D-glucopyranose	C8 H15 N O6	1
R16	Hexadecane	C16 H34	3
PLM	Palmitic acid	C16 H32 O2	2
CLR	Cholesterol	C27 H46 O	2

Primary citation

CryoEM structure of human full-length beta3gamma2 GABA(A) receptor in complex with GARLH4, the TMD of Neuroligin2 and Megabody25, in a closed state (StateC1). Kasaragod, V.B., Aricescu, A.R. To be published.

Other PDB entries of the same protein (UniProt P28472 (AlphaFold model), which also has an AlphaFold model), best resolution first:

7A5V 1.7 Å, CryoEM structure of a human gamma-aminobutyric acid receptor, the GABA(A)R-beta3…
9RGD 2.0 Å, CryoEM structure of human alpha1beta3gamma2L GABA(A)R in CL47a
9EQG 2.4 Å, CryoEM structure of human full-length alpha1beta3gamma2L GABA(A)R in complex with GABA…
6QFA 2.49 Å, CryoEM structure of a beta3K279T GABA(A)R homomer in complex with histamine and megabody…
7QN5 2.5 Å, Cryo-EM structure of human full-length extrasynaptic alpha4beta3delta GABA(A)R in…
9FAS 2.5 Å, CryoEM structure of human full-length alpha1beta3gamma2L GABA(A)R in complex with…
9FEU 2.5 Å, Cryo-EM structure of the beta3 homomeric GABA(A) receptor in complex with HSM in the…
9FFU 2.5 Å, Cryo-EM structure of the alpha1beta3 GABA(A) receptor in complex with GABA and Mb25 in…
9G2E 2.5 Å, Cryo-EM structure of the beta3 homomeric GABA(A) receptor in the long-lived desensitised…
9QJS 2.52 Å, GABA-A receptor a2b3 (1:4) + a2NB16(silent) + b3Mb125 + GABA
8PET 2.6 Å, Cryo-EM structure of the full-length human alpha1beta3 GABA(A) receptor (babba…
9FAJ 2.6 Å, CryoEM structure of human full-length alpha1beta3gamma2 GABA(A) receptor in complex with…

Browse structure collections

About this viewer

MolViewer shows 9FAU directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.