The crystal structure of the SARS-CoV-2 receptor binding domain in complex with the neutralizing nanobody 4. Determined by X-ray diffraction at 1.21 Å resolution. Released 11 Jun 2025.
Explore 9FC2 in 3D Show helices and sheets RCSB PDB PDBe
9FC2 contains 14 α-helices and 27 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 334 | 1 | |
| β-strand | 335 | 1 | 1 |
| α-helix | 336 | 1 | |
| α-helix | 338-342 | 5 | |
| β-strand | 349 | 1 | 2 |
| α-helix | 350-352 | 3 | |
| β-strand | 354-358 | 5 | 2 |
| β-strand | 361-362 | 2 | 1 |
| α-helix | 365-370 | 6 | |
| β-strand | 376-380 | 5 | 2 |
| α-helix | 384-389 | 6 | |
| β-strand | 391-392 | 2 | 1 |
| β-strand | 394-403 | 10 | 2 |
| α-helix | 404-409 | 6 | |
| α-helix | 417-421 | 5 | |
| β-strand | 431-437 | 7 | 2 |
| α-helix | 439-442 | 4 | |
| β-strand | 452-454 | 3 | 3 |
| α-helix | 460-462 | 3 | |
| α-helix | 471-472 | 2 | |
| β-strand | 473-474 | 2 | 4 |
| β-strand | 483-484 | 2 | 5 |
| β-strand | 485 | 1 | 4 |
| β-strand | 488-489 | 2 | 4 |
| β-strand | 492-494 | 3 | 3 |
| α-helix | 503-505 | 3 | |
| β-strand | 507-516 | 10 | 2 |
| β-strand | 524-525 | 2 | 1 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 2-7 | 6 | 6 |
| β-strand | 10-13 | 4 | 5 |
| β-strand | 18-26 | 9 | 6 |
| β-strand | 28-39 | 12 | 5 |
| β-strand | 46-52 | 7 | 5 |
| β-strand | 55-59 | 5 | 5 |
| β-strand | 66-71 | 6 | 6 |
| α-helix | 72-74 | 3 | |
| β-strand | 76-81 | 6 | 6 |
| α-helix | 86-88 | 3 | |
| β-strand | 90-100 | 11 | 5 |
| β-strand | 107-110 | 4 | 5 |
| β-strand | 114-119 | 6 | 5 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Spike protein S1 | A | protein | 207 | Severe acute respiratory syndrome coronavirus 2 | P0DTC2 (AlphaFold model) |
| Nanobody 4 | B | protein | 125 | Camelus dromedarius |
>9FC2_1 Spike protein S1 (chains A) GSITNLCPFGEVFNATRFASVYAWNRKRISNCVADYSVLYNSASFSTFKCYGVSPTKLND LCFTNVYADSFVIRGDEVRQIAPGQTGKIADYNYKLPDDFTGCVIAWNSNNLDSKVGGNY NYLYRLFRKSNLKPFERDISTEIYQAGSTPCNGVEGFNCYFPLQSYGFQPTNGVGYQPYR VVVLSFELLHAPATVCGPKKSTNLVPR
>9FC2_2 Nanobody 4 (chains B) QVQLVESGGGSVQAGGSLRLSCAASGDTGRTCNLVWYRQAPGKELEFVSSISDGSTNYAG SVKGRFTISQDNAKNTVYLQMNSLKPEDTAVYYCAATISRTGSLWCEEYWGQGTQVTVSS ALVPR
| ID | Name | Formula | Copies |
|---|---|---|---|
| NAG | 2-acetamido-2-deoxy-beta-D-glucopyranose | C8 H15 N O6 | 1 |
Water and common crystallization additives (EDO, ACT) are not listed.
Integrating immune library probing with structure-based computational design to develop potent neutralizing nanobodies against emerging SARS-CoV-2 variants. Cerdan, L., Silva, K., Rodriguez-Martin, D. et al. MAbs (2025) 17:2499595-2499595. DOI 10.1080/19420862.2025.2499595 · PubMed
Other PDB entries of the same protein (UniProt P0DTC2 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 9FC2 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.