9FIX: PDB entry 9FIX

MU2 adaptin subunit (AP50) of AP2 adaptor (second domain), complexed with LRP6 internalization peptide syrpysyrhfa. Determined by X-ray diffraction at 2.78 Å resolution. Released 23 Apr 2025.

Method: X-ray diffraction
Resolution: 2.78 Å
Organisms: Homo sapiens, Rattus norvegicus
Chains: 2
Atoms: 2,089
Mol. weight: 34.34 kDa
Released: 23 Apr 2025

Explore 9FIX in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

9FIX contains 3 α-helices and 21 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 0 helices, 1 β-strand

Element	Residues	Length	Sheet
β-strand	371	1	1

Chain M: 3 helices, 20 β-strands

Element	Residues	Length	Sheet
β-strand	172-185	14	1
β-strand	191-205	15	1
β-strand	211-215	5	2
β-strand	218	1	3
β-strand	241	1	3
β-strand	245	1	1
β-strand	248	1	1
β-strand	252-253	2	2
β-strand	263-265	3	2
α-helix	267-268	2
β-strand	270-279	10	1
β-strand	287-296	10	4
β-strand	300-309	10	4
β-strand	316-325	10	1
β-strand	330-337	8	4
β-strand	341-345	5	1
β-strand	350-359	10	1
β-strand	362-372	11	4
α-helix	373-374	2
α-helix	384-385	2
β-strand	386-392	7	1
β-strand	403-407	5	2
β-strand	419-433	15	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Low-density lipoprotein receptor-related protein 6	A	protein	11	Homo sapiens	O75581 (AlphaFold model)
AP-2 complex subunit mu	M	protein	286	Rattus norvegicus	P84092 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>9FIX_1 Low-density lipoprotein receptor-related protein 6 (chains A)
SYRPYSYRHFA

Sequence of entity 2 (M), FASTA

>9FIX_2 AP-2 complex subunit mu (chains M)
MHHHHHHMQIGWRREGIKYRRNELFLDVLESVNLLMSPQGQVLSAHVSGRVVMKSYLSGM
PECKFGMNDKIVIEKQGKGTADETSKSGKQSIAIDDCTFHQCVRLSKFDSERSISFIPPD
GEFELMRYRTTKDIILPFRVIPLVREVGRTKLEVKVVIKSNFKPSLLAQKIEVRIPTPLN
TSGVQVICMKGKAKYKASENAIVWKIKRMAGMKESQISAEIELLPTNDKKKWARPPISMN
FEVPFAPSGLKVRYLKVFEPKLNYSDHDVIKWVRYIGRSGIYETRC

Primary citation

MU2 ADAPTIN SUBUNIT (AP50) OF AP2 ADAPTOR (SECOND DOMAIN), COMPLEXED WITH LRP6 INTERNALIZATION PEPTIDE SYRPYSYRHFA. Gammons, M.V. To be published.

Other PDB entries of the same protein (UniProt O75581 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3SOV 1.27 Å, The structure of a beta propeller domain in complex with peptide S
7NAM 1.6 Å, LRP6_E1 in complex with Lr-EET-3.5
8FFE 1.72 Å, Crystal structure of LRP6 E1E2 domains bound to YW210.09 Fab and engineered XWnt8 peptide
3SOB 1.9 Å, The structure of the first YWTD beta propeller domain of LRP6 in complex with a FAB
3SOQ 1.9 Å, The structure of the first YWTD beta propeller domain of LRP6 in complex with a DKK1…
4A0P 1.9 Å, Crystal structure of LRP6P3E3P4E4
8DVM 2.0 Å, Crystal structure of LRP6 E3E4 in complex with disulfide constrained peptide E3.6
4NM5 2.3 Å, Crystal structure of GSK-3/Axin complex bound to phosphorylated Wnt receptor LRP6 c-motif
4NM7 2.3 Å, Crystal structure of GSK-3/Axin complex bound to phosphorylated Wnt receptor LRP6 e-motif
8DVL 2.5 Å, Crystal structure of LRP6 E3E4 in complex with disulfide constrained peptide E3.18
5AIR 2.53 Å, Structural analysis of mouse GSK3beta fused with LRP6 peptide.
8DVN 2.53 Å, Crystal structure of LRP6 E3E4 in complex with disulfide constrained peptide E3.10

Browse structure collections

About this viewer

MolViewer shows 9FIX directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.