9FOR: TAR DNA-binding protein 43

Structure of heteromeric amyloid filament of TDP-43 and AXNA11 from FTLD-TDP Type C (variant 1). Determined by electron microscopy at 2.75 Å resolution. Released 24 Jul 2024.

Method: Electron microscopy
Resolution: 2.75 Å
Organism: Homo sapiens
Chains: 10
Atoms: 3,405
Mol. weight: 49.16 kDa
Released: 24 Jul 2024

Explore 9FOR in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

9FOR contains 0 α-helices and 55 β-strands across 10 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chains A, C, E, G and o: 0 helices, 8 β-strands

Element	Residues	Length	Sheet
β-strand	289-293	5	1
β-strand	297-298	2	2
β-strand	301	1	3
β-strand	306	1	4
β-strand	311-312	2	5
β-strand	317-318	2	6
β-strand	321-338	18	7
β-strand	341-344	4	8

Chains B, D, F, H and p: 0 helices, 3 β-strands

Element	Residues	Length	Sheet
β-strand	40-50	11	9
β-strand	57-65	9	10
β-strand	72-73	2	11

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
TAR DNA-binding protein 43	A, C, E, G, o	protein	62	Homo sapiens	Q13148 (AlphaFold model)
Annexin A11	B, D, F, H, p	protein	36	Homo sapiens	P50995 (AlphaFold model)

Sequence of entity 1 (A, C, E, G, o), FASTA

>9FOR_1 TAR DNA-binding protein 43 (chains A, C, E, G, o)
GNQGGFGNSRGGGAGLGNNQGSNMGGGMNFGAFSINPAMMAAAQAALQSSWGMMGMLASQ
QN

Sequence of entity 2 (B, D, F, H, p), FASTA

>9FOR_2 Annexin A11 (chains B, D, F, H, p)
LDNVATYAGQFNQDYLSGMAANMSGTFGGANMPNLY

Primary citation

Heteromeric amyloid filaments of ANXA11 and TDP-43 in FTLD-TDP Type C. Arseni, D., Nonaka, T., Jacobsen, M.H. et al. bioRxiv (2024). DOI 10.1101/2024.06.25.600403 · PubMed

Other PDB entries of the same protein (UniProt Q13148 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6CF4 0.75 Å, Segment NFGTFS, with familial mutation A315T and phosphorylated threonine, from the low…
5WHP 1.0 Å, Crystal structure of the segment, NFGTFS, from the A315T familial variant of the low…
5WKB 1.0 Å, MicroED structure of the segment, NFGEFS, from the A315E familial variant of the low…
5WIA 1.0 Å, Crystal structure of the segment, GNNSYS, from the low complexity domain of TDP-43,…
5WHN 1.1 Å, Crystal structure of the segment, NFGAFS, from the low complexity domain of TDP-43,…
5WIQ 1.25 Å, Crystal structure of the segment, GFNGGFG, from the low complexity domain of TDP-43,…
5W50 1.4 Å, Crystal structure of the segment, LIIKGI, from the RRM2 of TDP-43, residues 248-253
5W52 1.4 Å, MicroED structure of the segment, DLIIKGISVHI, from the RRM2 of TDP-43, residues 247-257
6CFH 1.5 Å, SWGMMGMLASQ segment from the low complexity domain of TDP-43
5WKD 1.8 Å, Crystal structure of the segment, GNNQGSN, from the low complexity domain of TDP-43,…
5MDI 2.1 Å, Crystal structure of TDP-43 N-terminal domain at 2.1 A resolution
7N9H 2.2 Å, Structure of the mammalian importin a1 bound to the TDP-43 NLS

Browse structure collections

About this viewer

MolViewer shows 9FOR directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.