9FUM: Dimeric 14-3-3 zeta

Dimeric 14-3-3 zeta in complex with MAP2c peptide containing pS435. Determined by X-ray diffraction at 2.45 Å resolution. Released 12 Feb 2025.

Method: X-ray diffraction
Resolution: 2.45 Å
Organisms: Homo sapiens, Rattus norvegicus
Chains: 4
Atoms: 3,903
Mol. weight: 58.72 kDa
Ligands: CD
Released: 12 Feb 2025

Explore 9FUM in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

9FUM contains 23 α-helices and 0 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 12 helices, 0 β-strands

Element	Residues	Length
α-helix	6-18	13
α-helix	22-34	13
α-helix	38-39	2
α-helix	41-70	30
α-helix	76-103	28
α-helix	104-108	5
α-helix	115-134	20
α-helix	138-162	25
α-helix	168-183	16
α-helix	188-204	17
α-helix	206-208	3
α-helix	214-231	18

Chain B: 11 helices, 0 β-strands

Element	Residues	Length
α-helix	6-18	13
α-helix	22-33	12
α-helix	38-40	3
α-helix	41-71	31
α-helix	76-103	28
α-helix	104-108	5
α-helix	115-133	19
α-helix	138-162	25
α-helix	168-183	16
α-helix	188-204	17
α-helix	218-232	15

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
14-3-3 protein zeta/delta	A, B	protein	248	Homo sapiens	P63104 (AlphaFold model)
Isoform 3 of Microtubule-associated protein 2	E, F	protein	8	Rattus norvegicus	P15146 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>9FUM_1 14-3-3 protein zeta/delta (chains A, B)
SVDMDKNELVQKAKLAEQAERYDDMAACMKSVTEQGAELSNEERNLLSVAYKNVVGARRS
SWRVVSSIEQKTEGAEKKQQMAREYREKIETELRDICNDVLSLLEKFLIPNASQAESKVF
YLKMKGDYYRYLAEVAAGDDKKGIVDQSQQAYQEAFEISKKEMQPTHPIRLGLALNFSVF
YYEILNSPEKACSLAKTAFDEAIAELDTLSEESYKDSTLIMQLLRDNLTLWTSDTQGDEA
EAGEGGEN

Sequence of entity 2 (E, F), FASTA

>9FUM_2 Isoform 3 of Microtubule-associated protein 2 (chains E, F)
RRLSNVSS

Ligands and cofactors

ID	Name	Formula	Copies
CD	Cadmium ion	Cd	5

Primary citation

Characterization of multiple binding sites on microtubule associated protein 2c recognized by dimeric and monomeric 14-3-3 zeta. Jansen, S., Narasimhan, S., Cabre Fernandez, P. et al. FEBS J (2025) 292:1991-2016. DOI 10.1111/febs.17405 · PubMed

Other PDB entries of the same protein (UniProt P63104 (AlphaFold model), which also has an AlphaFold model), best resolution first:

2O02 1.5 Å, Phosphorylation independent interactions between 14-3-3 and Exoenzyme S: from structure…
6F09 1.59 Å, Binary complex of 14-3-3 zeta with ubiquitin specific protease 8 (USP8) pSer718 peptide
7ZIT 1.79 Å, 14-3-3 in complex with SARS-COV2 N phospho-peptide
9UJ2 1.8 Å, 14-3-3 zeta chimera with the S202R peptide of SARS-CoV-2 N (residues 200-213)
6ZFG 1.85 Å, 14-3-3 zeta chimera with 18E6 and fusicoccin
6F08 1.9 Å, 14-3-3 zeta in complex with the human Son of sevenless homolog 1 (SOS1)
6ZFD 1.9 Å, 14-3-3 zeta bound to the phosphorylated 18E6 C-terminus
4FJ3 1.95 Å, 14-3-3 isoform zeta in complex with a diphoyphorylated C-RAF peptide
5EXA 1.95 Å, Small-molecule stabilization of the 14-3-3/Gab2 PPI interface
8P1H 1.95 Å, Crystal structure of the chimera of human 14-3-3 zeta and phosphorylated cytoplasmic…
8A9G 1.96 Å, Binary complex of 14-3-3 zeta Glucocorticoid Receptor (GR) pT524 peptide stabilised by…
1QJA 2.0 Å, 14-3-3 zeta/phosphopeptide complex (mode 2)

Browse structure collections

About this viewer

MolViewer shows 9FUM directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.