9FYX: RNA polymerase II subunit D

Influenza A/H7N9 polymerase pre-cleavage cap-snatching complex. Determined by electron microscopy at 3.3 Å resolution. Released 16 Jul 2025.

Method: Electron microscopy
Resolution: 3.3 Å
Organisms: Sus scrofa domesticus, synthetic construct, Influenza B virus
Chains: 23
Atoms: 56,176
Mol. weight: 925.2 kDa
Ligands: ZN, G1G, MG, PO4
Released: 16 Jul 2025

Explore 9FYX in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

9FYX contains 322 α-helices and 388 β-strands across 17 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain a: 35 helices, 28 β-strands

Element	Residues	Length	Sheet
α-helix	2-7	6
α-helix	11-24	14
α-helix	32-48	17
β-strand	53-54	2	90
β-strand	73-74	2	90
β-strand	76-78	3	91
α-helix	84-98	15
β-strand	109-111	3	91
β-strand	116-123	8	91
α-helix	127-138	12
β-strand	144-149	6	91
β-strand	154-156	3	91
α-helix	157-159	3
α-helix	165-185	21
α-helix	188-191	4
α-helix	210-217	8
α-helix	226-234	9
α-helix	241-248	8
α-helix	256-257	2
β-strand	258-259	2	92
α-helix	265-271	7
β-strand	275	1	93
α-helix	276	1
β-strand	287	1	94
β-strand	290-292	3	94
α-helix	303-311	9
β-strand	317-324	8	94
α-helix	331-350	20
β-strand	359-360	2	94
α-helix	364-369	6
α-helix	376	1
β-strand	377-378	2	95
α-helix	381-383	3
β-strand	391-392	2	95
α-helix	393-394	2
α-helix	396-398	3
β-strand	402	1	93
α-helix	405-414	10
β-strand	417	1	96
β-strand	421	1	97
α-helix	425-431	7
α-helix	434-451	18
β-strand	453	1	96
α-helix	454-475	22
β-strand	480-488	9	94
β-strand	490	1	97
β-strand	498-506	9	94
β-strand	517-526	10	94
α-helix	530-532	3
α-helix	534-537	4
β-strand	541-551	11	94
β-strand	556-571	16	94
α-helix	572-579	8
α-helix	583-603	21
α-helix	608-609	2
α-helix	610-614	5
β-strand	619-624	6	98
β-strand	627-631	5	98
α-helix	633-649	17
α-helix	653-673	21
β-strand	679-680	2	92
α-helix	683-691	9
α-helix	698-714	17

Chain A: 82 helices, 76 β-strands

Element	Residues	Length	Sheet
α-helix	14	1
β-strand	15	1	34
β-strand	20-22	3	35
β-strand	25	1	36
α-helix	28-34	7
β-strand	43	1	37
β-strand	47-48	2	38
β-strand	51-52	2	38
α-helix	53	1
β-strand	56	1	37
α-helix	60-62	3
α-helix	82-85	4
β-strand	86-94	9	39
α-helix	97-99	3
α-helix	100-109	10
β-strand	110	1	40
β-strand	117	1	40
α-helix	124-132	9
α-helix	137-148	12
β-strand	153	1	41
β-strand	187	1	41
α-helix	188-189	2
β-strand	190-194	5	42
β-strand	197-201	5	42
β-strand	213-216	4	42
α-helix	218-227	10
α-helix	230-235	6
α-helix	246-248	3
β-strand	250-255	6	39
α-helix	256	1
β-strand	265	1	43
β-strand	271	1	43
α-helix	272-274	3
α-helix	275-295	21
α-helix	301-318	18
α-helix	326-327	2
β-strand	329	1	44
α-helix	331-333	3
α-helix	334	1
β-strand	335	1	44
α-helix	336	1
α-helix	339-342	4
α-helix	350-354	5
β-strand	357-359	3	45
β-strand	362-369	8	46
β-strand	377-379	3	46
β-strand	381	1	47
α-helix	382-387	6
β-strand	389-393	5	48
α-helix	394	1
α-helix	399-408	10
β-strand	416-420	5	48
β-strand	426-428	3	48
α-helix	435-438	4
β-strand	445-449	5	48
α-helix	450	1
β-strand	455-459	5	46
α-helix	466-468	3
β-strand	469-474	6	46
β-strand	477	1	47
β-strand	482-484	3	46
α-helix	487-489	3
β-strand	500-504	5	46
α-helix	509-514	6
α-helix	515-519	5
β-strand	520	1	46
α-helix	522-524	3
β-strand	526-527	2	49
β-strand	532-533	2	49
α-helix	539-548	10
β-strand	554-555	2	50
α-helix	557-565	9
α-helix	574	1
β-strand	575	1	12
α-helix	576-577	2
β-strand	579-581	3	13
β-strand	585	1	13
β-strand	586-587	2	50
α-helix	588-595	8
β-strand	602-604	3	51
β-strand	628-631	4	51
β-strand	634-637	4	51
α-helix	642-645	4
α-helix	652-659	8
α-helix	662-683	22
β-strand	686	1	52
α-helix	689-692	4
α-helix	696-721	26
α-helix	726-728	3
α-helix	733-759	27
α-helix	765-772	8
α-helix	778-785	8
β-strand	789-790	2	53
β-strand	792-793	2	54
β-strand	796-797	2	54
α-helix	798-799	2
β-strand	822-823	2	53
α-helix	833-868	36
β-strand	872-873	2	55
β-strand	879-880	2	55
β-strand	886-888	3	55
α-helix	891-893	3
β-strand	896	1	56
β-strand	902-905	4	57
α-helix	913-920	8
α-helix	927-933	7
β-strand	934	1	58
α-helix	936-944	9
α-helix	946-969	24
β-strand	976-979	4	57
α-helix	983-993	11
β-strand	1002	1	58
α-helix	1006-1019	14
α-helix	1028-1048	21
α-helix	1051-1056	6
α-helix	1062-1079	18
β-strand	1080	1	56
α-helix	1081-1082	2
α-helix	1087-1101	15
α-helix	1121-1129	9
β-strand	1139-1142	4	59
β-strand	1143	1	60
α-helix	1146-1149	4
α-helix	1152-1161	10
β-strand	1162	1	61
β-strand	1164-1165	2	62
α-helix	1166-1169	4
β-strand	1170-1177	8	16
α-helix	1181-1183	3
α-helix	1190-1197	8
β-strand	1210-1216	7	16
α-helix	1218-1223	6
α-helix	1228-1239	12
β-strand	1243-1247	5	16
β-strand	1256-1261	6	16
α-helix	1281-1295	15
β-strand	1297-1299	3	62
β-strand	1301	1	61
β-strand	1307-1310	4	59
α-helix	1315-1317	3
β-strand	1319-1322	4	63
β-strand	1328-1331	4	63
β-strand	1335-1338	4	59
α-helix	1343-1347	5
β-strand	1352	1	60
β-strand	1358-1359	2	59
α-helix	1362-1368	7
α-helix	1371-1388	18
α-helix	1395-1405	11
α-helix	1416-1419	4
α-helix	1426-1432	7
α-helix	1435-1445	11
β-strand	1448-1449	2	35
α-helix	1454-1459	6
α-helix	1462-1464	3
α-helix	1467-1469	3
β-strand	1471-1475	5	1
α-helix	1477-1480	4

Chain b: 38 helices, 31 β-strands

Element	Residues	Length	Sheet
β-strand	2-3	2	98
α-helix	5-10	6
α-helix	15-21	7
α-helix	27-30	4
α-helix	36-48	13
β-strand	54-57	4	99
β-strand	64-67	4	99
α-helix	72-74	3
α-helix	85-98	14
α-helix	102-116	15
β-strand	118	1	100
α-helix	119-123	5
β-strand	128-130	3	101
β-strand	135-137	3	101
α-helix	139-152	14
β-strand	162	1	100
α-helix	163-175	13
β-strand	178-185	8	102
β-strand	206-213	8	102
α-helix	214-222	9
β-strand	223-224	2	103
β-strand	225-228	4	104
β-strand	240-243	4	104
α-helix	246-264	19
β-strand	269	1	92
α-helix	275-292	18
β-strand	298-305	8	92
β-strand	306	1	105
α-helix	309-312	4
α-helix	315-325	11
α-helix	331-345	15
β-strand	348-350	3	103
β-strand	354-359	6	95
β-strand	364-369	6	95
α-helix	370-372	3
α-helix	378-380	3
α-helix	383-392	10
α-helix	393-395	3
β-strand	396-397	2	103
β-strand	400-402	3	103
α-helix	413-425	13
α-helix	429-432	4
β-strand	437-443	7	92
β-strand	446-453	8	92
α-helix	456-473	18
β-strand	477	1	105
β-strand	483-486	4	92
β-strand	489-492	4	106
β-strand	495-498	4	106
β-strand	501	1	106
α-helix	505-508	4
α-helix	519-535	17
α-helix	541-559	19
α-helix	573-582	10
α-helix	586-588	3
α-helix	591-593	3
α-helix	608-611	4
α-helix	618-624	7
α-helix	637-639	3
β-strand	642-645	4	107
β-strand	653-656	4	107
β-strand	667-668	2	108
α-helix	669-671	3
α-helix	673-676	4
α-helix	680-699	20
α-helix	702-705	4
β-strand	713	1	109
α-helix	714-732	19
α-helix	737-756	20

Chain B: 52 helices, 83 β-strands

Element	Residues	Length	Sheet
α-helix	16-18	3
α-helix	19-36	18
α-helix	41-49	9
α-helix	50-54	5
α-helix	55-61	7
α-helix	63-64	2
β-strand	67-68	2	64
β-strand	83-84	2	64
β-strand	87-93	7	64
β-strand	97-99	3	65
β-strand	105-107	3	65
α-helix	110-116	7
β-strand	121-133	13	64
β-strand	139-153	15	64
α-helix	168-173	6
β-strand	185-187	3	66
β-strand	190-193	4	66
α-helix	194-195	2
β-strand	196-200	5	67
β-strand	205-208	4	68
β-strand	215-223	9	68
β-strand	233-240	8	68
β-strand	256-259	4	68
β-strand	263	1	69
β-strand	267-268	2	68
α-helix	269-275	7
α-helix	281-288	8
α-helix	295-307	13
α-helix	314-324	11
β-strand	325	1	69
α-helix	332-345	14
α-helix	349-351	3
α-helix	358-376	19
α-helix	381-384	4
α-helix	388-390	3
β-strand	391-394	4	67
α-helix	396-423	28
α-helix	431-434	4
α-helix	437-450	14
β-strand	453	1	70
β-strand	463	1	70
β-strand	468-469	2	66
α-helix	470-471	2
α-helix	475-482	8
β-strand	484	1	71
β-strand	485-486	2	67
α-helix	503-505	3
β-strand	509	1	72
β-strand	525	1	71
β-strand	526	1	72
β-strand	531-532	2	73
α-helix	539-547	9
β-strand	551-552	2	74
α-helix	558-561	4
β-strand	565-569	5	74
β-strand	572-577	6	74
α-helix	580-592	13
β-strand	602-606	5	74
β-strand	611-615	5	74
β-strand	621-627	7	73
β-strand	628	1	75
β-strand	633	1	75
α-helix	637-644	8
α-helix	653-658	6
β-strand	662-666	5	73
α-helix	667-670	4
β-strand	675-676	2	73
α-helix	679-682	4
β-strand	695-696	2	73
α-helix	700-703	4
α-helix	706-709	4
α-helix	714-716	3
β-strand	717	1	76
α-helix	719-728	10
β-strand	732	1	77
β-strand	734	1	21
β-strand	747-751	5	21
β-strand	755	1	19
β-strand	759-760	2	78
α-helix	764-767	4
β-strand	776-782	7	79
β-strand	783	1	52
β-strand	793-797	5	79
α-helix	798-802	5
β-strand	808-817	10	21
β-strand	827-829	3	80
β-strand	848	1	81
β-strand	853	1	82
β-strand	854	1	81
α-helix	855	1
β-strand	859-860	2	21
β-strand	865-867	3	82
β-strand	869-872	4	80
β-strand	889-891	3	80
α-helix	893	1
β-strand	894-895	2	82
α-helix	896-897	2
β-strand	902-911	10	21
β-strand	917-927	11	21
β-strand	934-937	4	79
β-strand	942-949	8	79
β-strand	956	1	83
β-strand	965-967	3	79
α-helix	969-971	3
β-strand	977	1	76
α-helix	978-993	16
β-strand	997-998	2	78
α-helix	1008-1016	9
β-strand	1025-1026	2	79
β-strand	1029	1	83
α-helix	1035	1
β-strand	1036	1	83
α-helix	1037	1
β-strand	1041-1050	10	79
β-strand	1051	1	77
β-strand	1060-1062	3	46
β-strand	1067	1	84
β-strand	1074	1	84
α-helix	1082-1083	2
β-strand	1084-1086	3	45
α-helix	1088-1097	10
α-helix	1100-1104	5
α-helix	1105-1109	5
β-strand	1113-1119	7	34
α-helix	1124	1
β-strand	1125	1	34
α-helix	1126	1
β-strand	1127-1129	3	85
β-strand	1134-1136	3	85
β-strand	1137	1	86
β-strand	1142	1	86
β-strand	1146-1152	7	34
α-helix	1153-1164	12
β-strand	1167	1	36
β-strand	1170-1172	3	35

Chain c: 38 helices, 42 β-strands

Element	Residues	Length	Sheet
α-helix	2-12	11
α-helix	14-22	9
β-strand	24	1	109
α-helix	25-31	7
α-helix	43-50	8
β-strand	57-59	3	108
α-helix	63-66	4
β-strand	70	1	110
β-strand	76	1	110
β-strand	78-82	5	108
α-helix	83	1
α-helix	88	1
β-strand	89-91	3	108
α-helix	93-102	10
α-helix	111-114	4
α-helix	116-126	11
β-strand	129-135	7	111
β-strand	141-148	8	112
α-helix	156-167	12
α-helix	170-172	3
α-helix	180-192	13
α-helix	200-211	12
β-strand	214-220	7	112
α-helix	226-229	4
α-helix	232-235	4
β-strand	236	1	111
β-strand	240-245	6	111
α-helix	252-271	20
α-helix	276-286	11
β-strand	287-289	3	113
β-strand	292-293	2	113
α-helix	295-298	4
α-helix	306-314	9
β-strand	319	1	114
β-strand	322-325	4	115
β-strand	328-335	8	115
β-strand	338-345	8	116
β-strand	351-358	8	116
β-strand	361-366	6	115
β-strand	371-377	7	115
β-strand	380-386	7	115
α-helix	391-405	15
α-helix	408-412	5
β-strand	421	1	117
α-helix	426	1
β-strand	427	1	117
α-helix	428-429	2
α-helix	430-440	11
α-helix	443-447	5
β-strand	451-453	3	118
β-strand	462-463	2	119
β-strand	469-470	2	119
β-strand	473-475	3	118
β-strand	478-480	3	115
β-strand	494	1	114
β-strand	497-498	2	120
β-strand	504-505	2	120
β-strand	511-513	3	120
α-helix	515-517	3
β-strand	529-531	3	113
α-helix	542-555	14
α-helix	557-566	10
α-helix	568-573	6
α-helix	575-577	3
α-helix	578-583	6
α-helix	586-605	20
α-helix	612-618	7
α-helix	619-622	4
α-helix	625-626	2
β-strand	635-640	6	121
β-strand	643-648	6	121
β-strand	653	1	122
β-strand	656-659	4	122
β-strand	664-667	4	122
β-strand	670-674	5	122
α-helix	675-677	3
β-strand	694-699	6	123
α-helix	712-715	4
β-strand	721-725	5	123
β-strand	731-736	6	123

Chain C: 11 helices, 13 β-strands

Element	Residues	Length	Sheet
β-strand	8-14	7	87
β-strand	18-24	7	87
α-helix	28-40	13
β-strand	44-55	12	22
α-helix	61-69	9
β-strand	72	1	22
β-strand	73	1	88
β-strand	99-106	8	22
α-helix	112	1
β-strand	113-116	4	89
α-helix	117-119	3
β-strand	121-122	2	22
β-strand	129	1	88
α-helix	130-132	3
α-helix	147-148	2
β-strand	149-153	5	89
β-strand	158-168	11	22
α-helix	174-176	3
β-strand	179-185	7	87
α-helix	200-202	3
α-helix	204-206	3
α-helix	218-220	3
β-strand	229-235	7	87
α-helix	241-270	30

Chain D: 9 helices, 1 β-strand

Element	Residues	Length	Sheet
α-helix	24-26	3
β-strand	30-31	2	1
α-helix	34-49	16
α-helix	55-58	4
α-helix	59-70	12
α-helix	77-89	13
α-helix	94-103	10
α-helix	108-114	7
α-helix	116-118	3
α-helix	124-136	13

Chain E: 12 helices, 13 β-strands

Element	Residues	Length	Sheet
α-helix	4-24	21
β-strand	26-27	2	2
α-helix	30-33	4
α-helix	37-44	8
β-strand	47	1	3
β-strand	52	1	3
α-helix	55-58	4
β-strand	60-64	5	2
β-strand	71-75	5	2
β-strand	81-82	2	4
α-helix	84-97	14
β-strand	101-106	6	2
β-strand	109-110	2	4
α-helix	112-120	9
β-strand	126-131	6	2
α-helix	132-135	4
α-helix	139-141	3
β-strand	147-150	4	5
α-helix	151-152	2
α-helix	153-163	11
α-helix	167-169	3
β-strand	172-173	2	5
α-helix	178-183	6
β-strand	190-197	8	5
β-strand	201-209	9	5

9 more chain groups are not listed. Open the entry in the viewer and use the sequence panel to see them.

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
RNA polymerase II subunit D	D	protein	184	Sus scrofa domesticus	A0A287ADR4 (AlphaFold model)
DNA-directed RNA polymerase II subunit E	E	protein	210	Sus scrofa domesticus	I3LSI7 (AlphaFold model)
DNA-directed RNA polymerases I, II, and III subunit RPABC2	F	protein	127	Sus scrofa domesticus	A0A4X1VEK9 (AlphaFold model)
DNA-directed RNA polymerase subunit	G	protein	171	Sus scrofa domesticus	A0A4X1VKG7 (AlphaFold model)
DNA-directed RNA polymerases I, II, and III subunit RPABC3	H	protein	150	Sus scrofa domesticus	I3LCB2
DNA-directed RNA polymerase II subunit RPB9	I	protein	125	Sus scrofa domesticus	P60899
DNA-directed RNA polymerases I, II, and III subunit RPABC5	J	protein	67	Sus scrofa domesticus	A0A4X1VYD0
DNA-directed RNA polymerase II subunit RPB11-a	K	protein	117	Sus scrofa domesticus	F1RKE4
RNA polymerase II, I and III subunit K	L	protein	58	Sus scrofa domesticus	A0A4X1TRS6
non-template DNA (43-mer)	N	DNA	43	synthetic construct
cap(1)-RNA (35-MER)	P	RNA	35	Influenza B virus
Template DNA (43-MER)	T	DNA	43	synthetic construct

11 more molecules are not listed.

Sequence of entity 1 (D), FASTA

>9FYX_1 RNA polymerase II subunit D (chains D)
MWGPAQPYSDSALSPKPRPFRAVFRGSALPFPAVRVEVRGRSMAAGGSDPRAGDVEEDAS
QLIFPKEFETAETLLNSEVHMLLEHRKQQNESAEDEQELSEVFMKTLNYTARFSRFKNRE
TIASVRSLLLQKKLHKFELACLANLCPETAEESKALIPSLEGRFEDEELQQILDDIQTKR
SFQY

Sequence of entity 2 (E), FASTA

>9FYX_2 DNA-directed RNA polymerase II subunit E (chains E)
MDDEEETYRLWKIRKTIMQLCHDRGYLVTQDELDQTLEEFKAQFGDKPSEGRPRRTDLTV
LVAHNDDPTDQMFVFFPEEPKVGIKTIKVYCQRMQEENITRALIVVQQGMTPSAKQSLVD
MAPKYILEQFLQQELLINITEHELVPEHVVMTKEEVTELLARYKLRENQLPRIQAGDPVA
RYFGIKRGQVVKIIRPSETAGRYITYRLVQ

Sequence of entity 3 (F), FASTA

>9FYX_3 DNA-directed RNA polymerases I, II, and III subunit RPABC2 (chains F)
MSDNEDNFDGDDFDDVEEDEGLDDLENAEEEGQENVEILPSGERPQANQKRITTPYMTKY
ERARVLGTRALQIAMCAPVMVELEGETDPLLIAMKELKARKIPIIIRRYLPDGSYEDWGV
DELIISD

Sequence of entity 4 (G), FASTA

>9FYX_4 DNA-directed RNA polymerase subunit (chains G)
MFYHISLEHEILLHPRYFGPNLLNTVKQKLFTEVEGTCTGKYGFVIAVTTIDNIGAGVIQ
PGRGFVLYPVKYKAIVFRPFKGEVVDAVVTQVNKVGLFTEIGPMSCFISRHSIPSEMEFD
PNSNPPCYKTMDEDIVIQQDDEIRLKIVGTRVDKNDIFAIGSLMDDYLGLV

Sequence of entity 5 (H), FASTA

>9FYX_5 DNA-directed RNA polymerases I, II, and III subunit RPABC3 (chains H)
MAGILFEDIFDVKDIDPEGKKFDRVSRLHCESESFKMDLILDVNIQIYPVDLGDKFRLVI
ASTLYEDGTLDDGEYNPTDDRPSRADQFEYVMYGKVYRIEGDETSTEAATRLSAYVSYGG
LLMRLQGDANNLHGFEVDSRVYLLMKKLAF

Sequence of entity 6 (I), FASTA

>9FYX_6 DNA-directed RNA polymerase II subunit RPB9 (chains I)
MEPDGTYEPGFVGIRFCQECNNMLYPKEDKENRILLYACRNCDYQQEADNSCIYVNKITH
EVDELTQIIADVSQDPTLPRTEDHPCQKCGHKEAVFFQSHSARAEDAMRLYYVCTAPHCG
HRWTE

Sequence of entity 7 (J), FASTA

>9FYX_7 DNA-directed RNA polymerases I, II, and III subunit RPABC5 (chains J)
MIIPVRCFTCGKIVGNKWEAYLGLLQAEYTEGDALDALGLKRYCCRRMLLAHVDLIEKLL
NYAPLEK

Sequence of entity 8 (K), FASTA

>9FYX_8 DNA-directed RNA polymerase II subunit RPB11-a (chains K)
MNAPPAFESFLLFEGEKKITINKDTKVPNACLFTINKEDHTLGNIIKSQLLKDPQVLFAG
YKVPHPLEHKIIIRVQTTPDYSPQEAFTNAITDLISELSLLEERFRVAIKDKQEGIE

Sequence of entity 9 (L), FASTA

>9FYX_9 RNA polymerase II, I and III subunit K (chains L)
MDTQKDVQPPKQQPMIYICGECHTENEIKSRDPIRCRECGYRIMYKKRTKRLVVFDAR

Sequence of entity 10 (N), FASTA

>9FYX_10 non-template DNA (43-mer) (chains N)
GGCAGTACTAGTATTCTAGTATTGAAAGTACTTGAGCTTGATC

Sequence of entity 11 (P), FASTA

>9FYX_11 cap(1)-RNA (35-MER) (chains P)
GAAGCGAGAAGAACACAGACAGCAGAAGACCAGGC

Sequence of entity 12 (T), FASTA

>9FYX_12 Template DNA (43-MER) (chains T)
GATCAAGCTCAAGTACTTAAGCCTGGTCTATACTAGTACTGCC

Ligands and cofactors

ID	Name	Formula	Copies
ZN	Zinc ion	Zn	9
G1G	7-methyl-guanosine-5'-triphosphate-5'-(2'-O-methyl)-guanosine	C22 H32 N10 O18 P3	1
MG	Magnesium ion	Mg	2
PO4	Phosphate ion	O4 P	2

Primary citation

Mechanism of co-transcriptional cap snatching by influenza polymerase. Rotsch, A.H., Li, D., Dupont, M. et al. Nature (2026) 652:1281-1288. DOI 10.1038/s41586-026-10189-0 · PubMed

Other PDB entries of the same protein (UniProt A0A287ADR4 (AlphaFold model), which also has an AlphaFold model), best resolution first:

9BZ0 1.9 Å, Structure of an STK19-containing TC-NER complex
7NVU 2.5 Å, RNA polymerase II core pre-initiation complex with open promoter DNA
7OOB 2.7 Å, Pol II-CSB-CSA-DDB1-UVSSA-ADPBeF3 (Structure2)
7F4G 2.78 Å, Structure of RPAP2-bound RNA polymerase II
7NVS 2.8 Å, RNA polymerase II core pre-initiation complex with closed promoter DNA in proximal…
7OO3 2.8 Å, Pol II-CSB-CSA-DDB1-UVSSA (Structure1)
8OEW 2.8 Å, Structure of the mammalian Pol II-Elongin complex, lacking the ELOA latch (composite…
8UHD 2.8 Å, Structure of paused transcription complex Pol II-DSIF-NELF - post-translocated
8OEV 2.86 Å, Structure of the mammalian Pol II-SPT6-Elongin complex, lacking ELOA latch (composite…
7NVT 2.9 Å, RNA polymerase II core pre-initiation complex with closed promoter DNA in distal position
7OOP 2.9 Å, Pol II-CSB-CSA-DDB1-UVSSA-PAF-SPT6 (Structure 3)
8S52 2.9 Å, RNA polymerase II core initially transcribing complex with an ordered RNA of 10 nt

Browse structure collections

About this viewer

MolViewer shows 9FYX directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.