9G0A: Transcription elongation factor SPT5

Influenza A/H7N9 polymerase post-cleavage cap-snatching complex. Determined by electron microscopy at 3.1 Å resolution. Released 16 Jul 2025.

Method: Electron microscopy
Resolution: 3.1 Å
Organisms: Homo sapiens, Sus scrofa domesticus, Influenza B virus
Chains: 23
Atoms: 55,830
Mol. weight: 926.85 kDa
Ligands: PO4, G1G, MG, ZN
Released: 16 Jul 2025

Explore 9G0A in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

9G0A contains 322 α-helices and 400 β-strands across 17 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain a: 37 helices, 33 β-strands

Element	Residues	Length	Sheet
α-helix	2-7	6
α-helix	11-24	14
α-helix	32-47	16
β-strand	52-54	3	49
β-strand	60-62	3	49
β-strand	73-74	2	49
β-strand	76-78	3	50
α-helix	84-98	15
α-helix	100-103	4
β-strand	109-111	3	50
β-strand	116-119	4	50
β-strand	122-123	2	51
α-helix	127-136	10
β-strand	144-145	2	50
β-strand	146-149	4	51
β-strand	154-156	3	51
α-helix	157-159	3
α-helix	165-184	20
α-helix	188-192	5
α-helix	210-217	8
α-helix	226-234	9
α-helix	241-248	8
β-strand	258-259	2	52
α-helix	265-268	4
β-strand	275	1	53
α-helix	276	1
β-strand	287	1	54
β-strand	290-292	3	55
α-helix	303-313	11
β-strand	317-324	8	55
α-helix	334-350	17
β-strand	358-359	2	55
α-helix	360-361	2
α-helix	364-369	6
α-helix	376	1
β-strand	377-378	2	56
α-helix	381-384	4
β-strand	391-392	2	56
α-helix	393-394	2
α-helix	396-400	5
β-strand	402	1	53
α-helix	405-414	10
β-strand	417	1	57
β-strand	421	1	55
α-helix	427-431	5
α-helix	434-451	18
β-strand	453	1	57
α-helix	454-475	22
β-strand	481-490	10	55
β-strand	496-506	11	55
β-strand	517-524	8	55
β-strand	526	1	54
α-helix	535-537	3
β-strand	541-547	7	55
β-strand	550	1	58
β-strand	557	1	58
α-helix	559	1
β-strand	560-571	12	55
α-helix	572-578	7
α-helix	581-583	3
α-helix	584-603	20
α-helix	608-609	2
α-helix	610-614	5
β-strand	619-624	6	59
β-strand	627-631	5	59
α-helix	633-649	17
α-helix	653-673	21
β-strand	679-680	2	52
α-helix	683-691	9
α-helix	698-714	17

Chain A: 79 helices, 79 β-strands

Element	Residues	Length	Sheet
α-helix	14	1
β-strand	15-16	2	13
β-strand	20-22	3	14
β-strand	25	1	15
α-helix	28-34	7
β-strand	43	1	16
β-strand	47-48	2	17
β-strand	51-52	2	17
α-helix	53	1
β-strand	56	1	16
α-helix	60-62	3
α-helix	82-85	4
β-strand	88-94	7	18
α-helix	97-99	3
α-helix	100-109	10
β-strand	110	1	19
β-strand	117	1	19
α-helix	124-132	9
α-helix	137-148	12
β-strand	153	1	20
β-strand	187	1	20
α-helix	188-189	2
β-strand	190-194	5	21
β-strand	197-201	5	21
β-strand	213-216	4	21
α-helix	218-226	9
α-helix	230-235	6
α-helix	246-248	3
β-strand	250-253	4	18
α-helix	254-256	3
β-strand	265	1	22
β-strand	271	1	22
α-helix	275-295	21
α-helix	300-318	19
α-helix	326-327	2
β-strand	329	1	23
α-helix	331-333	3
β-strand	335	1	23
α-helix	336-338	3
α-helix	350-354	5
β-strand	357-359	3	24
β-strand	362-369	8	25
β-strand	377-381	5	25
α-helix	382-387	6
β-strand	389-393	5	26
α-helix	394	1
α-helix	399-408	10
β-strand	416-420	5	26
β-strand	426-428	3	26
α-helix	436-438	3
β-strand	445-449	5	26
α-helix	450	1
β-strand	455-459	5	25
α-helix	466-468	3
β-strand	469-477	9	25
β-strand	482-484	3	25
α-helix	487-489	3
β-strand	500-504	5	25
α-helix	509-518	10
β-strand	520	1	25
α-helix	522-524	3
β-strand	526-527	2	27
β-strand	532-533	2	27
α-helix	539-548	10
β-strand	554-555	2	28
α-helix	557-564	8
α-helix	574	1
β-strand	575	1	29
α-helix	576-577	2
β-strand	579-581	3	30
β-strand	585	1	30
β-strand	586-587	2	28
α-helix	588-595	8
β-strand	602-603	2	31
β-strand	629-631	3	31
β-strand	634-637	4	31
α-helix	642-645	4
α-helix	652-659	8
α-helix	662-683	22
β-strand	686	1	32
α-helix	689-692	4
α-helix	696-721	26
α-helix	726-728	3
α-helix	733-759	27
α-helix	765-772	8
α-helix	778-781	4
α-helix	782-786	5
β-strand	789-790	2	33
β-strand	793	1	34
β-strand	796	1	34
α-helix	797-799	3
β-strand	802	1	35
β-strand	805	1	35
β-strand	822-823	2	33
α-helix	833-867	35
β-strand	872-873	2	36
β-strand	879-880	2	36
β-strand	886-888	3	36
α-helix	891-893	3
β-strand	896	1	37
β-strand	902-905	4	38
α-helix	913-920	8
α-helix	927-933	7
β-strand	934	1	39
α-helix	936-944	9
α-helix	947-969	23
β-strand	976-979	4	38
α-helix	983-993	11
α-helix	1001	1
β-strand	1002	1	39
α-helix	1006-1019	14
α-helix	1028-1037	10
α-helix	1039-1048	10
α-helix	1053-1056	4
α-helix	1062-1079	18
β-strand	1080	1	37
α-helix	1081-1082	2
α-helix	1087-1096	10
α-helix	1098-1100	3
α-helix	1121-1128	8
β-strand	1139-1142	4	40
β-strand	1143	1	41
α-helix	1146-1148	3
α-helix	1152-1161	10
β-strand	1162	1	42
β-strand	1164-1165	2	43
α-helix	1166-1169	4
β-strand	1170-1177	8	44
α-helix	1190-1197	8
β-strand	1207	1	45
β-strand	1210-1216	7	44
α-helix	1218-1223	6
α-helix	1228-1238	11
α-helix	1240-1242	3
β-strand	1245-1247	3	44
β-strand	1256-1259	4	44
β-strand	1262	1	45
α-helix	1281-1294	14
β-strand	1297-1299	3	43
β-strand	1301	1	42
β-strand	1307-1310	4	40
β-strand	1319-1322	4	46
β-strand	1328-1331	4	46
β-strand	1335-1338	4	40
α-helix	1343-1346	4
β-strand	1352	1	41
β-strand	1358-1359	2	40
α-helix	1362-1368	7
α-helix	1371-1387	17
α-helix	1395-1404	10
β-strand	1408	1	47
α-helix	1416-1419	4
α-helix	1426-1430	5
α-helix	1435-1445	11
β-strand	1448-1449	2	14
α-helix	1454-1459	6
α-helix	1467-1469	3
β-strand	1471-1475	5	48

Chain b: 42 helices, 30 β-strands

Element	Residues	Length	Sheet
β-strand	2-3	2	59
α-helix	5-10	6
α-helix	15-21	7
α-helix	27-28	2
α-helix	30-32	3
α-helix	36-48	13
β-strand	54-57	4	60
β-strand	64-67	4	60
α-helix	72-74	3
α-helix	85-98	14
α-helix	102-116	15
β-strand	118	1	61
α-helix	119-123	5
β-strand	128-130	3	62
β-strand	135-137	3	62
α-helix	139-152	14
α-helix	158-160	3
β-strand	162	1	61
α-helix	163-175	13
β-strand	178-183	6	63
β-strand	208-213	6	63
α-helix	214-222	9
β-strand	223-224	2	64
β-strand	225-228	4	65
β-strand	240-243	4	65
β-strand	245	1	62
α-helix	246-263	18
β-strand	269	1	52
α-helix	276-292	17
β-strand	298-306	9	52
α-helix	309-312	4
α-helix	315-325	11
α-helix	331-345	15
β-strand	348-350	3	64
β-strand	355-359	5	56
β-strand	364-368	5	56
α-helix	370-374	5
α-helix	378-380	3
α-helix	383-392	10
α-helix	393-395	3
β-strand	396-397	2	64
β-strand	400-402	3	64
α-helix	413-425	13
α-helix	429-432	4
β-strand	437-443	7	52
β-strand	446-453	8	52
α-helix	456-473	18
β-strand	477-486	10	52
β-strand	489-492	4	66
β-strand	495-498	4	66
β-strand	501	1	66
α-helix	506-511	6
α-helix	521-535	15
α-helix	541-559	19
α-helix	573-582	10
α-helix	586-588	3
α-helix	591-593	3
α-helix	595-597	3
α-helix	601-603	3
α-helix	608-612	5
α-helix	618-624	7
α-helix	637-639	3
β-strand	642-645	4	67
β-strand	653-656	4	67
β-strand	667-668	2	68
α-helix	669-671	3
α-helix	673-676	4
α-helix	680-699	20
α-helix	701-703	3
β-strand	713	1	69
α-helix	714-732	19
α-helix	737-756	20

Chain B: 53 helices, 79 β-strands

Element	Residues	Length	Sheet
α-helix	16-18	3
α-helix	19-36	18
α-helix	41-49	9
α-helix	50-54	5
α-helix	55-61	7
α-helix	63-64	2
β-strand	67-68	2	84
β-strand	83-84	2	84
β-strand	87-93	7	84
β-strand	97-99	3	85
β-strand	105-107	3	85
α-helix	110-116	7
β-strand	121-133	13	84
β-strand	140-153	14	84
α-helix	168-173	6
β-strand	185-187	3	86
β-strand	190-193	4	86
α-helix	194-195	2
β-strand	196-200	5	87
β-strand	206-208	3	88
β-strand	215-223	9	88
β-strand	233-240	8	88
α-helix	254-255	2
β-strand	256-259	4	88
β-strand	267-268	2	88
α-helix	269-275	7
α-helix	281-288	8
α-helix	295-307	13
α-helix	314-324	11
α-helix	332-341	10
α-helix	342-346	5
α-helix	356-359	4
α-helix	361-376	16
α-helix	381-384	4
α-helix	388-390	3
β-strand	391-394	4	87
α-helix	396-423	28
α-helix	431-434	4
α-helix	438-450	13
β-strand	453	1	89
β-strand	463	1	89
β-strand	468-469	2	86
α-helix	470-471	2
α-helix	475-482	8
β-strand	484	1	90
β-strand	485-486	2	87
α-helix	503-505	3
β-strand	509	1	91
β-strand	525	1	90
β-strand	526	1	91
β-strand	531-532	2	92
α-helix	539-547	9
β-strand	551-552	2	93
α-helix	558-561	4
β-strand	565-569	5	93
β-strand	572-577	6	93
α-helix	580-592	13
β-strand	602-605	4	93
β-strand	611-615	5	93
β-strand	621-627	7	92
β-strand	628	1	94
β-strand	633	1	94
α-helix	637-644	8
α-helix	653-658	6
β-strand	662-666	5	92
α-helix	667-670	4
β-strand	675-676	2	92
α-helix	679-682	4
β-strand	695-696	2	92
α-helix	700-703	4
α-helix	706-709	4
α-helix	714-716	3
β-strand	717	1	95
α-helix	719-728	10
β-strand	732	1	96
β-strand	734	1	97
β-strand	747-751	5	97
β-strand	755	1	98
β-strand	759-760	2	99
α-helix	764-767	4
β-strand	776-782	7	100
β-strand	783	1	32
β-strand	793-797	5	100
α-helix	798-802	5
β-strand	808-817	10	97
β-strand	827-829	3	101
β-strand	853	1	102
α-helix	854-855	2
β-strand	859-860	2	97
β-strand	865-867	3	102
β-strand	869-872	4	101
β-strand	889-891	3	101
α-helix	893	1
β-strand	894-895	2	102
α-helix	896-897	2
β-strand	902-911	10	97
β-strand	917-927	11	97
β-strand	934-937	4	100
β-strand	942-949	8	100
β-strand	956	1	103
β-strand	965-967	3	100
α-helix	971-975	5
β-strand	977	1	95
α-helix	978-993	16
β-strand	997-998	2	99
α-helix	1008-1015	8
α-helix	1016-1018	3
β-strand	1025-1026	2	100
β-strand	1029	1	103
α-helix	1035	1
β-strand	1036	1	103
α-helix	1037	1
β-strand	1041-1050	10	100
β-strand	1051	1	96
β-strand	1060-1062	3	25
β-strand	1067	1	104
β-strand	1074	1	104
α-helix	1082-1083	2
β-strand	1084-1086	3	24
α-helix	1088-1097	10
α-helix	1100-1104	5
α-helix	1105-1109	5
β-strand	1113-1119	7	13
β-strand	1125	1	13
β-strand	1127-1129	3	105
β-strand	1134-1136	3	105
β-strand	1137	1	106
β-strand	1142	1	106
β-strand	1146-1152	7	13
α-helix	1153-1163	11
β-strand	1167	1	15
β-strand	1170-1172	3	14

Chain c: 39 helices, 43 β-strands

Element	Residues	Length	Sheet
α-helix	2-12	11
α-helix	14-22	9
β-strand	24	1	69
α-helix	25-31	7
α-helix	38-40	3
α-helix	43-50	8
β-strand	57-59	3	68
α-helix	61-65	5
β-strand	70	1	70
β-strand	76	1	70
β-strand	78-82	5	68
α-helix	83	1
α-helix	88	1
β-strand	89-91	3	68
α-helix	93-102	10
α-helix	111-114	4
α-helix	116-126	11
β-strand	129-135	7	71
α-helix	140	1
β-strand	141-148	8	72
α-helix	156-167	12
α-helix	180-192	13
α-helix	200-211	12
β-strand	214-220	7	72
α-helix	226-229	4
α-helix	232-235	4
β-strand	236	1	71
β-strand	240-245	6	71
α-helix	252-271	20
α-helix	276-286	11
β-strand	288-289	2	73
β-strand	292-293	2	73
α-helix	294-297	4
α-helix	308-315	8
α-helix	317-318	2
β-strand	319	1	74
β-strand	322-325	4	75
β-strand	328-335	8	75
β-strand	338-345	8	76
β-strand	351-358	8	76
β-strand	361-366	6	75
β-strand	371-377	7	75
β-strand	380-386	7	75
α-helix	391-405	15
α-helix	408-411	4
β-strand	421	1	77
β-strand	427	1	77
α-helix	430-440	11
α-helix	443-449	7
β-strand	451-453	3	78
α-helix	454-455	2
β-strand	460-461	2	75
β-strand	462-463	2	79
β-strand	469-470	2	79
β-strand	473-475	3	78
β-strand	478-481	4	75
β-strand	494	1	74
β-strand	497-498	2	80
β-strand	504-505	2	80
β-strand	511-513	3	80
α-helix	515-517	3
β-strand	529-530	2	73
α-helix	542-555	14
α-helix	557-566	10
α-helix	568-572	5
α-helix	575-577	3
α-helix	578-581	4
α-helix	586-605	20
α-helix	612-618	7
α-helix	619-622	4
α-helix	625-626	2
β-strand	635-640	6	81
β-strand	643-648	6	81
β-strand	656-659	4	82
β-strand	664-667	4	82
β-strand	670-674	5	82
α-helix	675-676	2
β-strand	691	1	83
β-strand	694-699	6	83
α-helix	712-715	4
β-strand	721-725	5	83
β-strand	731-736	6	83

Chain C: 10 helices, 18 β-strands

Element	Residues	Length	Sheet
β-strand	8-14	7	107
β-strand	18-24	7	107
α-helix	28-40	13
β-strand	44-49	6	108
β-strand	50-51	2	109
β-strand	52-55	4	110
α-helix	61-69	9
β-strand	73	1	111
β-strand	99-100	2	108
β-strand	101-102	2	112
β-strand	103-106	4	110
α-helix	112	1
β-strand	113-116	4	113
α-helix	117-119	3
β-strand	121-122	2	112
β-strand	129	1	111
α-helix	145-148	4
β-strand	149-153	5	113
β-strand	158-161	4	110
β-strand	164-168	5	108
α-helix	174-176	3
β-strand	179-182	4	107
β-strand	185-186	2	107
α-helix	200-202	3
α-helix	204-206	3
α-helix	218-220	3
β-strand	229-235	7	107
α-helix	241-269	29

Chain D: 9 helices, 3 β-strands

Element	Residues	Length	Sheet
β-strand	16	1	126
β-strand	21	1	126
α-helix	24-26	3
β-strand	30-31	2	48
α-helix	34-49	16
α-helix	55-58	4
α-helix	59-70	12
α-helix	78-89	12
α-helix	94-103	10
α-helix	108-114	7
α-helix	116-118	3
α-helix	124-137	14

Chain E: 11 helices, 13 β-strands

Element	Residues	Length	Sheet
α-helix	4-24	21
β-strand	26-27	2	114
α-helix	30-33	4
α-helix	37-43	7
β-strand	47	1	115
β-strand	52	1	115
β-strand	60-64	5	114
β-strand	71-75	5	114
β-strand	81-82	2	116
α-helix	84-96	13
β-strand	101-106	6	114
β-strand	109-110	2	116
α-helix	112-120	9
β-strand	126-131	6	114
α-helix	132-135	4
α-helix	139-141	3
β-strand	147-150	4	47
α-helix	151-152	2
α-helix	153-163	11
α-helix	167-169	3
β-strand	172-173	2	47
α-helix	178-183	6
β-strand	190-197	8	47
β-strand	201-209	9	47

9 more chain groups are not listed. Open the entry in the viewer and use the sequence panel to see them.

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Transcription elongation factor SPT5	Z	protein	1087	Homo sapiens	O00267 (AlphaFold model)
Transcription elongation factor SPT4	Y	protein	117	Homo sapiens	P63272 (AlphaFold model)
DNA-directed RNA polymerase subunit	A	protein	1641	Sus scrofa domesticus	I3LJR4
5' cap(1) RNA	P	RNA	35	Influenza B virus
Polymerase acidic protein	a	protein	717	Influenza A virus (A/Zhejiang/DTID-ZJU01/2013(H7N9))	M9TI86
RNA-directed RNA polymerase catalytic subunit	b	protein	757	Influenza A virus (A/Zhejiang/DTID-ZJU01/2013(H7N9))	M9TLW3
Polymerase basic protein 2	c	protein	759	Influenza A virus (A/Zhejiang/DTID-ZJU01/2013(H7N9))	X5F427
3' vRNA	r	RNA	13	Influenza B virus
5' vRNA	v	RNA	14	Influenza B virus
likely linker between KOWx4 and KOW5 domains of SPT5	X	protein	14	Homo sapiens
DNA-directed RNA polymerase subunit beta	B	protein	1174	Sus scrofa domesticus	A0A0B8RVL1
DNA-directed RNA polymerase II subunit RPB3	C	protein	275	Sus scrofa domesticus	I3LCH3

11 more molecules are not listed.

Sequence of entity 1 (Z), FASTA

>9G0A_1 Transcription elongation factor SPT5 (chains Z)
MSDSEDSNFSEEEDSERSSDGEEAEVDEERRSAAGSEKEEEPEDEEEEEEEEEYDEEEEE
EDDDRPPKKPRHGGFILDEADVDDEYEDEDQWEDGAEDILEKEEIEASNIDNVVLDEDRS
GARRLQNLWRDQREEELGEYYMKKYAKSSVGETVYGGSDELSDDITQQQLLPGVKDPNLW
TVKCKIGEERATAISLMRKFIAYQFTDTPLQIKSVVAPEHVKGYIYVEAYKQTHVKQAIE
GVGNLRLGYWNQQMVPIKEMTDVLKVVKEVANLKPKSWVRLKRGIYKDDIAQVDYVEPSQ
NTISLKMIPRIDYDRIKARMSLKDWFAKRKKFKRPPQRLFDAEKIRSLGGDVASDGDFLI
FEGNRYSRKGFLFKSFAMSAVITEGVKPTLSELEKFEDQPEGIDLEVVTESTGKEREHNF
QPGDNVEVCEGELINLQGKILSVDGNKITIMPKHEDLKDMLEFPAQELRKYFKMGDHVKV
IAGRFEGDTGLIVRVEENFVILFSDLTMHELKVLPRDLQLCSETASGVDVGGQHEWGELV
QLDPQTVGVIVRLERETFQVLNMYGKVVTVRHQAVTRKKDNRFAVALDSEQNNIHVKDIV
KVIDGPHSGREGEIRHLFRSFAFLHCKKLVENGGMFVCKTRHLVLAGGSKPRDVTNFTVG
GFAPMSPRISSPMHPSAGGQRGGFGSPGGGSGGMSRGRGRRDNELIGQTVRISQGPYKGY
IGVVKDATESTARVELHSTCQTISVDRQRLTTVGSRRPGGMTSTYGRTPMYGSQTPMYGS
GSRTPMYGSQTPLQDGSRTPHYGSQTPLHDGSRTPAQSGAWDPNNPNTPSRAEEEYEYAF
DDEPTPSPQAYGGTPNPQTPGYPDPSSPQVNPQYNPQTPGTPAMYNTDQFSPYAAPSPQG
SYQPSPSPQSYHQVAPSPAGYQNTHSPASYHPTPSPMAYQASPSPSPVGYSPMTPGAPSP
GGYNPHTPGSGIEQNSSDWVTTDIQVKVRDTYLDTQVVGQTGVIRSVTGGMCSVYLKDSE
KVVSISSEHLEPITPTKNNKVKVILGEDREATGVLLSIDGEDGIVRMDLDEQLKILNLRF
LGKLLEA

Sequence of entity 2 (Y), FASTA

>9G0A_2 Transcription elongation factor SPT4 (chains Y)
MALETVPKDLRHLRACLLCSLVKTIDQFEYDGCDNCDAYLQMKGNREMVYDCTSSSFDGI
IAMMSPEDSWVSKWQRVSNFKPGVYAVSVTGRLPQGIVRELKSRGVAYKSRDTAIKT

Sequence of entity 3 (A), FASTA

>9G0A_3 DNA-directed RNA polymerase subunit (chains A)
SACPLRTIKRVQFGVLSPDELKRMSVTEGGIKYPETTEGGRPKLGGLMDPRQGVIERTGR
CQTCAGNMTECPGHFGHIELAKPVFHVGFLVKTMKVLRCVCFFCSKLLVDSNNPKIKDIL
AKSKGQPKKRLTHVYDLCKGKNICEGGEEMDNKFGVEQPEGDEDLTKEKGHGGCGRYQPR
IRRSGLELYAEWKHVNEDSQEKKILLSPERVHEIFKRISDEECFVLGMEPRYARPEWMIV
TVLPVPPLSVRPAVVMQGSARNQDDLTHKLADIVKINNQLRRNEQNGAAAHVIAEDVKLL
QFHVATMVDNELPGLPRAMQKSGRPLKSLKQRLKGKEGRVRGNLMGKRVDFSARTVITPD
PNLSIDQVGVPRSIAANMTFAEIVTPFNIDRLQELVRRGNSQYPGAKYIIRDNGDRIDLR
FHPKPSDLHLQTGYKVERHMCDGDIVIFNRQPTLHKMSMMGHRVRILPWSTFRLNLSVTT
PYNADFDGDEMNLHLPQSLETRAEIQELAMVPRMIVTPQSNRPVMGIVQDTLTAVRKFTK
RDVFLERGEVMNLLMFLSTWDGKVPQPAILKPRPLWTGKQIFSLIIPGHINCIRTHSTHP
DDEDSGPYKHISPGDTKVVVENGELIMGILCKKSLGTSAGSLVHISYLEMGHDITRLFYS
NIQTVINNWLLIEGHTIGIGDSIADSKTYQDIQNTIKKAKQDVIEVIEKAHNNELEPTPG
NTLRQTFENQVNRILNDARDKTGSSAQKSLSEYNNFKSMVVSGAKGSKINISQVIAVVGQ
QNVEGKRIPFGFKHRTLPHFIKDDYGPESRGFVENSYLAGLTPTEFFFHAMGGREGLIDT
AVKTAETGYIQRRLIKSMESVMVKYDATVRNSINQVVQLRYGEDGLAGESVEFQNLATLK
PSNKAFEKKFRFDYTNERALRRTLQEDLVKDVLSNAHIQNELEREFERMREDREVLRVIF
PTGDSKVVLPCNLLRMIWNAQKIFHINPRLPSDLHPIKVVEGVKELSKKLVIVNGDDPLS
RQAQENATLLFNIHLRSTLCSRRMAEEFRLSGEAFDWLLGEIESKFNQAIAHPGEMVGAL
AAQSLGEPATQMTLNTFHYAGVSAKNVTLGVPRLKELINISKKPKTPSLTVFLLGQSARD
AERAKDILCRLEHTTLRKVTANTAIYYDPNPQSTVVAEDQEWVNVYYEMPDFDVARISPW
LLRVELDRKHMTDRKLTMEQIAEKINAGFGDDLNCIFNDDNAEKLVLRIRIMNSDENKMQ
EEEEVVDKMDDDVFLRCIESNMLTDMTLQGIEQISKVYMHLPQTDNKKKIIITEDGEFKA
LQEWILETDGVSLMRVLSEKDVDPVRTTSNDIVEIFTVLGIEAVRKALERELYHVISFDG
SYVNYRHLALLCDTMTCRGHLMAITRHGVNRQDTGPLMKCSFEETVDVLMEAAAHGESDP
MKGVSENIMLGQLAPAGTGCFDLLLDAEKCKYGMEIPTNIPGLGAAGPTGMFFGSAPSPM
GGISPAMTPWNQGATPAYGAWSPSVGSGMTPGAAGFSPSAASDASGFSPGYSPAWSPTPG
SPGSPGPSSPYIPSPGGAMSPSYSPTSPAYEPRSPGGYTPQSPSYSPTSPSYSPTSPSYS
PTSPNYSPTSPSYSPTSPSYS

Sequence of entity 4 (P), FASTA

>9G0A_4 5' cap(1) RNA (chains P)
GAAGCGAGAAGAACACAGACAGCAGCAGACCAGGC

Sequence of entity 5 (a), FASTA

>9G0A_5 Polymerase acidic protein (chains a)
GMEDFVRQCFNPMIVELAEKAMKEYGEDPKIETNKFASICTHLEVCFMYSDFHFIDERGE
STIIESGDPNVLLKHRFEIIEGRDRTMAWTVVNSICNTTGVEKPKFLPDLYDYKENRFID
IGVTRREVHIYYLEKANKIKSEKTHIHIFSFTGEEMATKADYTLDEESRARIKTRLFTIR
QEMASRGLWDSFRQSERGEETIEERFEITGTMRRLADQSLPPNFSSLENFRAYVDGFEPN
GCIEGKLSQMSKEVNARIEPFLRTTPRPLRLPDGPPCSQRSKFLLMDALKLSIEDPSHEG
EGIPLYDAIKCMKTFFGWKEPNIIKPHEKGINPNYLLTWKQVLAELQDIENEEKIPRTKN
MKKTSQLKWALGENMAPEKVDFEDCKDVNDLKQYDSDEPEPRSLACWIQSEFNKACELTD
SSWVELDEIGEDVAPIEHIASMRRNYFTAEVSHCRATEYIMKGVYINTALLNASCAAMDD
FQLIPMISKCRTKEGRRKTNLYGFIIKGRSHLRNDTDVVNFVSMEFSLTDPRLEPHKWEK
YCVLEIGDMLLRTAVGQVSRPMFLYVRTNGTSKIKMKWGMEMRRCLLQSLQQIESMIEAE
SSVKEKDLTKEFFENKSETWPIGESPKGVEEGSIGKVCRTLLAKSVFNSLYASPQLEGFS
AESRKLLLIVQALRDNLEPGTFDLEGLYEAIEECLINDPWVLLNASWFNSFLTHALR

Sequence of entity 6 (b), FASTA

>9G0A_6 RNA-directed RNA polymerase catalytic subunit (chains b)
MDVNPTLLFLKVPVQNAISTTFPYTGDPPYSHGTGTGYTMDTVNRTHKYSEKGKWTTNTE
TGAPQLNPIDGPLPEDNEPSGYAQTDCVLEAMAFLEESHPGIFENSCLETMEIVQQTRVD
KLTQGRQTYDWTLNRNQPAATALANTIEVFRSNGLTANESGRLIDFLKDVMDSMDKEEME
ITTHFQRKRRVRDNMTKKMVTQRTIGKKKQRLNKRSYLIRALTLNTMTKDAERGKLKRRA
IATPGMQIRGFVYFVEALARSICEKLEQSGLPVGGNEKKAKLANVVRKMMTNSQDTELSF
TITGDNTKWNENQNPRMFLAMITYITRNQPEWFRNVLSIAPIMFSNKMARLGKGYMFESK
SMKLRTQVPAEMLANIDLKYFNKSTREKIEKIRPLLIDGTASLSPGMMMGMFNMLSTVLG
VSILNLGQKKYTKTTYWWDGLQSSDDFALIVNAPNHEGIQAGVDRFYRTCKLVGINMSKK
KSYINRTGTFEFTSFFYRYGFVANFSMELPSFGVSGINESADMSVGVTVIKNNMINNDLG
PATAQMALQLFIKDYRYTYRCHRGDTQIQTRRAFELKKLWEQTRSKAGLLVSDGGPNLYN
IRNLHIPEVCLKWELMDEDYQGRLCNPMNPFVSHKEIDSVNNAVVMPAHGPAKSMEYDAV
ATTHSWIPKRNRSILNTSQRGILEDEQMYQKCCNLFEKFFPSSSYRRPVGISSMVEAMVS
RARIDARIDFESGRIKKEEFAEIMKICSTIEELRRQK

Sequence of entity 7 (c), FASTA

>9G0A_7 Polymerase basic protein 2 (chains c)
MERIKELRDLMSQSRTREILTKTTVDHMAIIKKYTSGRQEKNPALRMKWMMAMKYPITAD
KRIMEMIPERNEQGQTLWSKTNDAGSDRVMVSPLAVTWWNRNGPTTSTVHYPKVYKTYFE
KVERLKHGTFGPVHFRNQVKIRRRVDINPGHADLSAKEAQDVIMEVVFPNEVGARILTSE
SQLTITKEKKKELQDCKIAPLMVAYMLERELVRKTRFLPVAGGTSSVYIEVLHLTQGTCW
EQMYTPGGEVRNDDVDQSLIIAARNIVRRATVSADPLASLLEMCHSTQIGGVRMVDILRQ
NPTEEQAVDICKAAMGLRISSSFSFGGFTFKRTSGSSVKREEEVLTGNLQTLKIRVHEGY
EEFTMVGRRATAILRKATRRLIQLIVSGKDEQSIAEAIIVAMVFSQEDCMIKAVRGDLNF
VNRANQRLNPMHQLLRHFQKDAKVLFQNWGIEPIDNVMGMIGILPDMTPSTEMSLRGVRV
SKMGVDEYSSTERVVVSIDRFLRVRDQRGNVLLSPEEVSETQGTEKLTITYSSSMMWEIN
GPESVLVNTYQWIIRNWENVKIQWSQDPTMLYNKMEFEPFQSLVPKAARGQYSGFVRVLF
QQMRDVLGTFDTVQIIKLLPFAAAPPEQSRMQFSSLTVNVRGSGMRIVVRGNSPVFNYNK
ATKRLTVLGKDAGALMEDPDEGTAGVESAVLRGFLILGKENKRYGPALSINELSNLAKGE
KANVLIGQGDVVLVMKRKRDSSILTDSQTATKRIRMAIN

Sequence of entity 8 (r), FASTA

>9G0A_8 3' vRNA (chains r)
CUCUGCUUCUGCU

Sequence of entity 9 (v), FASTA

>9G0A_9 5' vRNA (chains v)
AGUAGUAACAAGAG

Sequence of entity 10 (X), FASTA

>9G0A_10 likely linker between KOWx4 and KOW5 domains of SPT5 (chains X)
AAAAAAFAAAAAAA

Sequence of entity 11 (B), FASTA

>9G0A_11 DNA-directed RNA polymerase subunit beta (chains B)
MYDADEDMQYDEDDDEITPDLWQEACWIVISSYFDEKGLVRQQLDSFDEFIQMSVQRIVE
DAPPIDLQAEAQHASGEVEEPPRYLLKFEQIYLSKPTHWERDGAPSPMMPNEARLRNLTY
SAPLYVDITKTVIKEGEEQLQTQHQKTFIGKIPIMLRSTYCLLNGLTDRDLCELNECPLD
PGGYFIINGSEKVLIAQEKMATNTVYVFAKKDSKYAYTGECRSCLENSSRPTSTIWVSML
ARGGQGAKKSAIGQRIVATLPYIKQEVPIIIVFRALGFVSDRDILEHIIYDFEDPEMMEM
VKPSLDEAFVIQEQNVALNFIGSRGAKPGVTKEKRIKYAKEVLQKEMLPHVGVSDFCETK
KAYFLGYMVHRLLLAALGRRELDDRDHYGNKRLDLAGPLLAFLFRGMFKNLLKEVRIYAQ
KFIDRGKDFNLELAIKTRIISDGLKYSLATGNWGDQKKAHQARAGVSQVLNRLTFASTLS
HLRRLNSPIGRDGKLAKPRQLHNTLWGMVCPAETPEGHAVGLVKNLALMAYISVGSQPSP
ILEFLEEWSMENLEEISPAAIADATKIFVNGCWVGIHKDPEQLMNTLRKLRRQMDIIVSE
VSMIRDIREREIRIYTDAGRICRPLLIVEKQKLLLKKRHIDQLKEREYNNYSWQDLVASG
VVEYIDTLEEETVMLAMTPDDLQEKEVAYCSTYTHCEIHPSMILGVCASIIPFPDHNQSP
RNTYQSAMGKQAMGVYITNFHVRMDTLAHVLYYPQKPLVTTRSMEYLRFRELPAGINSIV
AIASYTGYNQEDSVIMNRSAVDRGFFRSVFYRSYKEQESKKGFDQEEVFEKPTRETCQGM
RHAIYDKLDDDGLIAPGVRVSGDDVIIGKTVTLPENEDELEGTNRRYTKRDCSTFLRTSE
TGIVDQVMVTLNQEGYKFCKIRVRSVRIPQIGDKFASRHGQKGTCGIQYRQEDMPFTCEG
ITPDIIINPHAIPSRMTIGHLIECLQGKVSANKGEIGDATPFNDAVNVQKISNLLSDYGY
HLRGNEVLYNGFTGRKITSQIFIGPTYYQRLKHMVDDKIHSRARGPIQILNRQPMEGRSR
DGGLRFGEMERDCQIAHGAAQFLRERLFEASDPYQVHVCNLCGIMAIANTRTHTYECRGC
RNKTQISLVRMPYACKLLFQELMSMSIAPRMMSV

Sequence of entity 12 (C), FASTA

>9G0A_12 DNA-directed RNA polymerase II subunit RPB3 (chains C)
MPYANQPTVRITELTDENVKFIIENTDLAVANSIRRVFIAEVPIIAIDWVQIDANSSVLH
DEFIAHRLGLIPLTSDDIVDKLQYSRDCTCEEFCPECSVEFTLDVRCNEDQTRHVTSRDL
ISNSPRVIPVTSRNRDNDPSDYVEQDDILIVKLRKGQELRLRAYAKKGFGKEHAKWNPTA
GVAFEYDPDNALRHTVYPKPEEWPKSEYSELDEDESQAPYDPNGKPERFYYNVESCGSLR
PETIVLSALSGLKKKLSDLQTQLSHEIQSDVLTIN

Ligands and cofactors

ID	Name	Formula	Copies
PO4	Phosphate ion	O4 P	3
G1G	7-methyl-guanosine-5'-triphosphate-5'-(2'-O-methyl)-guanosine	C22 H32 N10 O18 P3	1
MG	Magnesium ion	Mg	2
ZN	Zinc ion	Zn	8

Primary citation

Mechanism of co-transcriptional cap snatching by influenza polymerase. Rotsch, A.H., Li, D., Dupont, M. et al. Nature (2026) 652:1281-1288. DOI 10.1038/s41586-026-10189-0 · PubMed

Other PDB entries of the same protein (UniProt O00267 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5OHQ 1.1 Å, Crystal structure of the KOW6-KOW7 domain of human DSIF
3H7H 1.55 Å, Crystal structure of the human transcription elongation factor DSIF, hSpt4/hSpt5 (176-273)
5OHO 1.6 Å, Crystal structure of the KOWx-KOW4 domain of human DSIF
5U98 2.0 Å, The crystal structure of a self-peptide complexed to Abacavir and HLA-B*57:01
9HVQ 2.0 Å, Structure of the transcribing Pol II-DSIF-PAF-SPT6-RECQL5 complex
9MLC 2.4 Å, Pol II-DSIF-SPT6-PAF1c-TFIIS-IWS1-ELOF1-LEDGF-nucleosome activated elongation complex…
4L1U 2.42 Å, Crystal Structure of Human Rtf1 Plus3 Domain in Complex with Spt5 CTR Phosphopeptide
8UHG 2.7 Å, Structure of paused transcription complex Pol II-DSIF-NELF - poised post-translocated
8UI0 2.7 Å, Structure of poised transcription complex Pol II-DSIF-NELF - pre-translocated
8UHD 2.8 Å, Structure of paused transcription complex Pol II-DSIF-NELF - post-translocated
9EGX 2.9 Å, RNA polymerase II-DSIF-SPT6-PAF1c-TFIIS-IWS1-hexasome, bp +27
9EGY 2.9 Å, RNA polymerase II-DSIF-SPT6-PAF1c-TFIIS-IWS1-nucleosome, bp +27

Browse structure collections

About this viewer

MolViewer shows 9G0A directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.