Crystal structure of CREBBP bromodomain in complex with (R,E)-6-(5-(7-methoxy-3,4-dihydroquinolin-1(2H)-yl)pent-1-en-1-yl)-4-methyl-8-(morpholine-4-carbonyl)-1,3,4,5-tetrahydro-2H-benzo[b][1,4]diazepin-2-one. Determined by X-ray diffraction at 1.29 Å resolution. Released 20 Aug 2025.
Explore 9GET in 3D Show helices and sheets RCSB PDB PDBe
9GET contains 8 α-helices and 0 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 1081-1084 | 4 | |
| α-helix | 1087-1102 | 16 | |
| α-helix | 1109-1111 | 3 | |
| α-helix | 1117-1120 | 4 | |
| α-helix | 1125-1128 | 4 | |
| α-helix | 1135-1143 | 9 | |
| α-helix | 1150-1167 | 18 | |
| α-helix | 1173-1195 | 23 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Crebbp | A | protein | 119 | Homo sapiens | Q92793 (AlphaFold model) |
>9GET_1 CREBBP (chains A) SMRKKIFKPEELRQALMPTLEALYRQDPESLPFRQPVDPQLLGIPDYFDIVKNPMDLSTI KRKLDTGQYQEPWQYVDDVWLMFNNAWLYNRKTSRVYKFCSKLAEVFEQEIDPVMQSLG
| ID | Name | Formula | Copies |
|---|---|---|---|
| A1IKM | (4~{R})-6-[(~{E})-5-(7-methoxy-3,4-dihydro-2~{H}-quinolin-1-yl)pent-1-enyl]-4-m… | C30 H38 N4 O4 | 1 |
Crystal structure of CREBBP bromodomain in complex with (R,E)-6-(5-(7-methoxy-3,4-dihydroquinolin-1(2H)-yl)pent-1-en-1-yl)-4-methyl-8-(morpholine-4-carbonyl)-1,3,4,5-tetrahydro-2H-benzo[b][1,4]diazepin-2-one. Amann, M., Boyd, A., Einsle, O. et al. To be published.
Other PDB entries of the same protein (UniProt Q92793 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 9GET directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.