Crystal structure of stabilized A2A adenosine receptor A2AR-StaR2-bRIL in complex with compound 7, a novel nanomolar A2A receptor antagonist from modern hit-finding with structure-guided de novo design. Determined by X-ray diffraction at 1.75 Å resolution. Released 18 Jun 2025.
Explore 9H2X in 3D Show helices and sheets RCSB PDB PDBe
9H2X contains 23 α-helices and 2 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 2-33 | 32 | |
| α-helix | 35-37 | 3 | |
| α-helix | 40-54 | 15 | |
| α-helix | 55-59 | 5 | |
| α-helix | 60-67 | 8 | |
| β-strand | 71-73 | 3 | 1 |
| α-helix | 74-107 | 34 | |
| α-helix | 109-115 | 7 | |
| α-helix | 118-136 | 19 | |
| α-helix | 138-141 | 4 | |
| α-helix | 151-156 | 6 | |
| β-strand | 163-165 | 3 | 1 |
| α-helix | 168-171 | 4 | |
| α-helix | 174-175 | 2 | |
| α-helix | 176-187 | 12 | |
| α-helix | 188-1018 | 39 | |
| α-helix | 1023-1040 | 18 | |
| α-helix | 1061-1080 | 20 | |
| α-helix | 1084-1092 | 9 | |
| α-helix | 1094-1097 | 4 | |
| α-helix | 1098-1102 | 5 | |
| α-helix | 1103-258 | 44 | |
| α-helix | 263-266 | 4 | |
| α-helix | 267-291 | 25 | |
| α-helix | 293-304 | 12 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Adenosine receptor A2a,Soluble cytochrome b562 | A | protein | 433 | Homo sapiens, Escherichia coli | P29274 (AlphaFold model) |
>9H2X_1 Adenosine receptor A2a,Soluble cytochrome b562 (chains A) DYKDDDDGAPPIMGSSVYITVELAIAVLAILGNVLVCWAVWLNSNLQNVTNYFVVSLAAA DILVGVLAIPFAITISTGFCAACHGCLFIACFVLVLAQSSIFSLLAIAIDRYIAIAIPLR YNGLVTGTRAAGIIAICWVLSFAIGLTPMLGWNNCGQPKEGKAHSQGCGEGQVACLFEDV VPMNYMVYFNFFACVLVPLLLMLGVYLRIFAAARRQLADLEDNWETLNDNLKVIEKADNA AQVKDALTKMRAAALDAQKATPPKLEDKSPDSPEMKDFRHGFDILVGQIDDALKLANEGK VKEAQAAAEQLKTTRNAYIQKYLERARSTLQKEVHAAKSAAIIAGLFALCWLPLHIINCF TFFCPDCSHAPLWLMYLAIVLAHTNSVVNPFIYAYRIREFRQTFRKIIRSHVLRQQEPFK AAAHHHHHHHHHH
| ID | Name | Formula | Copies |
|---|---|---|---|
| A1IR1 | 4-(furan-2-yl)-6-(6-imidazol-1-ylpyridin-2-yl)-1,3,5-triazin-2-amine | C15 H11 N7 O | 1 |
| OLA | Oleic acid | C18 H34 O2 | 21 |
| CLR | Cholesterol | C27 H46 O | 3 |
Water and common crystallization additives (NA) are not listed.
Identification of nanomolar adenosine A 2A receptor ligands using reinforcement learning and structure-based drug design. Thomas, M., Matricon, P.G., Gillespie, R.J. et al. Nat Commun (2025) 16:5485-5485. DOI 10.1038/s41467-025-60629-0 · PubMed
Other PDB entries of the same protein (UniProt P29274 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 9H2X directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.