6LPK: PDB entry 6LPK

Name: PDB 6LPK: A2AR crystallized in EROCOC17+4, LCP-SFX at 293 K
Published: 2020-11-25
License: https://creativecommons.org/publicdomain/zero/1.0/
Keywords: membrane protein

A2AR crystallized in EROCOC17+4, LCP-SFX at 293 K. Determined by X-ray diffraction at 1.8 Å resolution. Released 25 Nov 2020.

Method: X-ray diffraction
Resolution: 1.8 Å
Organisms: Homo sapiens, Escherichia coli
Chains: 1
Atoms: 3,583
Mol. weight: 56.06 kDa
Ligands: ZMA, CLR, D12, MYS
Released: 25 Nov 2020

Explore 6LPK in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6LPK contains 22 α-helices and 2 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 22 helices, 2 β-strands

Element	Residues	Length	Sheet
α-helix	2-33	32
α-helix	35-37	3
α-helix	40-54	15
α-helix	55-59	5
α-helix	60-67	8
β-strand	71-73	3	1
α-helix	74-107	34
α-helix	109-115	7
α-helix	118-136	19
α-helix	138-141	4
α-helix	151-157	7
β-strand	163-165	3	1
α-helix	168-171	4
α-helix	174-175	2
α-helix	176-187	12
α-helix	188-1018	39
α-helix	1023-1041	19
α-helix	1059-1080	22
α-helix	1084-1097	14
α-helix	1098-1102	5
α-helix	1103-258	44
α-helix	263-264	2
α-helix	267-291	25
α-helix	293-306	14

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Adenosine receptor A2a,Soluble cytochrome b562,Adenosine receptor A2a	A	protein	447	Homo sapiens, Escherichia coli	P0ABE7 (AlphaFold model), P29274 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>6LPK_1 Adenosine receptor A2a,Soluble cytochrome b562,Adenosine receptor A2a (chains A)
MKTIIALSYIFCLVFADYKDDDDGAPPIMGSSVYITVELAIAVLAILGNVLVCWAVWLNS
NLQNVTNYFVVSLAAADIAVGVLAIPFAITISTGFCAACHGCLFIACFVLVLTQSSIFSL
LAIAIDRYIAIRIPLRYNGLVTGTRAKGIIAICWVLSFAIGLTPMLGWNNCGQPKEGKNH
SQGCGEGQVACLFEDVVPMNYMVYFNFFACVLVPLLLMLGVYLRIFLAARRQLADLEDNW
ETLNDNLKVIEKADNAAQVKDALTKMRAAALDAQKATPPKLEDKSPDSPEMKDFRHGFDI
LVGQIDDALKLANEGKVKEAQAAAEQLKTTRNAYIQKYLERARSTLQKEVHAAKSLAIIV
GLFALCWLPLHIINCFTFFCPDCSHAPLWLMYLAIVLSHTNSVVNPFIYAYRIREFRQTF
RKIIRSHVLRQQEPFKAHHHHHHHHHH

Ligands and cofactors

ID	Name	Formula	Copies
ZMA	4-{2-[(7-amino-2-furan-2-yl[1,2,4]triazolo[1,5-a][1,3,5]triazin-5-yl)amino]ethy…	C16 H15 N7 O2	1
CLR	Cholesterol	C27 H46 O	3
D12	Dodecane	C12 H26	1
MYS	Pentadecane	C15 H32	6
HEX	Hexane	C6 H14	1
8K6	Octadecane	C18 H38	3
D10	Decane	C10 H22	1
ER0	[(2~{R},3~{S})-2,3,4-tris(oxidanyl)butyl] (5~{R},9~{R},13~{R})-5,9,13,17-tetram…	C26 H52 O5	2
TRD	Tridecane	C13 H28	4
UND	Undecane	C11 H24	1
OCT	N-octane	C8 H18	3

Water and common crystallization additives (NA) are not listed.

Primary citation

Isoprenoid-chained lipid EROCOC 17+4 : a new matrix for membrane protein crystallization and a crystal delivery medium in serial femtosecond crystallography. Ihara, K., Hato, M., Nakane, T. et al. Sci Rep (2020) 10:19305-19305. DOI 10.1038/s41598-020-76277-x · PubMed

Other PDB entries of the same protein (UniProt P0ABE7 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6DYF 1.1 Å, Cu(II)-bound structure of the engineered cyt cb562 variant, CH3Y
5YO6 1.2 Å, Crystal Structure of B562RIL with engineered disulfide bond T9C-A36C
4JEA 1.22 Å, Crystal structure of an engineered Zn-RIDC1 construct with four interfacial disulfide…
7LSJ 1.26 Å, Cu-bound crystal structure of the engineered cyt cb562 variant, DiCyt2 - H63A,…
7MK4 1.27 Å, Co-bound crystal structure of the engineered cyt cb562 variant, DiCyt2
6DYC 1.33 Å, Co(II)-bound structure of the engineered cyt cb562 variant, CH3
5YO4 1.37 Å, Crystal Structure of B562RIL with engineered disulfide bond K27C-A79C
256B 1.4 Å, Improvement of the 2.5 Å resolution model of cytochrome B562 by redetermining the…
6OT4 1.4 Å, Bimetallic dodecameric cage design 2 (BMC2) from cytochrome cb562
7LRV 1.4 Å, Ni-bound crystal structure of the engineered cyt cb562 variant, DiCyt2, crystallized in…
9PQ4 1.48 Å, Bi-bound structure of the H77C variant of TriCyt2
6DYG 1.49 Å, Fe(II)-bound structure of the engineered cyt cb562 variant, CH3Y

Browse structure collections

About this viewer

MolViewer shows 6LPK directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.