9H8H: DC11 anti tau antibody Fab fragment

Structure of DC11 anti tau antibody Fab fragment. Determined by X-ray diffraction at 1.33 Å resolution. Released 12 Nov 2025.

Method: X-ray diffraction
Resolution: 1.33 Å
Organism: Mus
Chains: 2
Atoms: 3,925
Mol. weight: 47.34 kDa
Released: 12 Nov 2025

Explore 9H8H in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

9H8H contains 22 α-helices and 47 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 13 helices, 24 β-strands

Element	Residues	Length	Sheet
β-strand	3-6	4	1
α-helix	7-9	3
β-strand	10-13	4	2
β-strand	18-25	8	1
α-helix	29-31	3
β-strand	34-40	7	2
β-strand	44-52	9	2
β-strand	57-60	4	2
α-helix	62-64	3
β-strand	68-73	6	1
α-helix	74-76	3
β-strand	78-83	6	1
α-helix	88-90	3
β-strand	92-98	7	2
β-strand	101-102	2	2
β-strand	106-111	6	2
α-helix	113-115	3
β-strand	116	1	3
α-helix	117-118	2
β-strand	119-123	5	4
α-helix	124-125	2
β-strand	126	1	5
β-strand	134-144	11	4
β-strand	145	1	3
β-strand	150-153	4	6
α-helix	154-156	3
β-strand	158	1	6
β-strand	162-164	3	4
α-helix	165-167	3
β-strand	168-170	3	4
β-strand	173-183	11	4
α-helix	184-186	3
β-strand	193-198	6	6
α-helix	199-201	3
β-strand	203-208	6	6
α-helix	209-211	3
β-strand	212	1	5

Chain D: 9 helices, 23 β-strands

Element	Residues	Length	Sheet
β-strand	4-7	4	7
β-strand	10-13	4	8
β-strand	19-25	7	7
β-strand	30	1	9
β-strand	36	1	9
β-strand	38-43	6	8
β-strand	50-54	5	8
β-strand	58-59	2	8
α-helix	60	1
β-strand	67-72	6	7
β-strand	75-80	6	7
α-helix	85-87	3
β-strand	89-95	7	8
α-helix	101	1
β-strand	102-103	2	8
β-strand	107-111	5	8
β-strand	116	1	10
α-helix	117-118	2
β-strand	119-123	5	11
α-helix	124-126	3
α-helix	127-130	4
β-strand	134-144	11	11
β-strand	145	1	10
β-strand	150-155	6	12
β-strand	158-160	3	12
β-strand	164-168	5	11
α-helix	169-172	4
β-strand	178-187	10	11
α-helix	188-191	4
β-strand	196-202	7	12
α-helix	209	1
β-strand	210-215	6	12

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
DC11	A	protein	214	Mus
Igk protein	D	protein	219	Mus	Q58EU8 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>9H8H_1 DC11 (chains A)
EVQLQQSGAELVRSGASVKLSCTASGFNIKDYYMHWVKQRPEQGLEWIGWIDPENADTEY
APKFQGKATMTADTSSNTAYLQLSSLTSEDTAVYYCKTGDYWGQGTTLTVSSAKTTPPSV
YPLAPGSAAQTNSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLESDLYTLSSSV
TVPSSTWPSETVTCNVAHPASSTKVDKKIVPRDC

Sequence of entity 2 (D), FASTA

>9H8H_2 Igk protein (chains D)
DVVMTQTPLTLSVTIGQPASISCKSSQSLLDSDGKTYLNWLLQRPGQSPKRLIFLVSKLD
SGVPDRFTGSGSGTDFTLKISRVEAEDLGVYYCWQKTHFPQTFGGGTNLEIKRADAAPTV
SIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSM
SSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC

Primary citation

Structure of DC11 anti tau antibody Fab fragment. Cehlar, O., Njemoga, S. To be published.

Other PDB entries of the same protein (UniProt Q58EU8 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1NCW 1.3 Å, Cationic Cyclization Antibody 4C6 in Complex with Benzoic Acid
1RUM 1.48 Å, Crystal structure (F) of H2O2-soaked cationic cyclization antibody 4C6 fab at pH 8.5…
1RUA 1.75 Å, Crystal structure (B) of u.v.-irradiated cationic cyclization antibody 4C6 fab at pH 4.6…
1YEJ 1.85 Å, Catalytic antibody complex
1KN2 1.9 Å, Catalytic antibody D2.3 complex
1KN4 1.9 Å, Catalytic antibody D2.3 complex
1YEI 1.9 Å, Catalytic antibody D2.3 complex
2C1P 2.0 Å, Fab-fragment of enantioselective antibody complexed with finrozole
1YEK 2.1 Å, Catalytic antibody D2.3 complex
1ND0 2.45 Å, Cationic cyclization antibody 4C6 complex with transition state analog
2C1O 2.75 Å, ENAIIHis Fab fragment in the free form

Browse structure collections

About this viewer

MolViewer shows 9H8H directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.