9HVD: Native human P-eIF2-eIF2B complex

Native human P-eIF2-eIF2B complex. Determined by electron microscopy at 3.04 Å resolution. Released 19 Nov 2025.

Method: Electron microscopy
Resolution: 3.04 Å
Organism: Homo sapiens
Chains: 12
Atoms: 31,306
Mol. weight: 594.89 kDa
Released: 19 Nov 2025

Explore 9HVD in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

9HVD contains 173 α-helices and 221 β-strands across 12 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 16 helices, 11 β-strands

Element	Residues	Length	Sheet
α-helix	3-16	14
α-helix	22-35	14
α-helix	42-59	18
α-helix	63-75	13
α-helix	86-104	19
α-helix	107-115	9
α-helix	116-118	3
β-strand	123-126	4	44
α-helix	132-142	11
β-strand	148-153	6	44
α-helix	160-169	10
β-strand	175-178	4	44
α-helix	183-186	4
β-strand	192-195	4	44
β-strand	200	1	45
β-strand	206-209	4	45
α-helix	212-221	10
β-strand	226-229	4	44
α-helix	232-234	3
β-strand	235	1	45
α-helix	243-245	3
α-helix	248-251	4
β-strand	273-276	4	45
α-helix	278-280	3
β-strand	283-286	4	44
β-strand	289-291	3	44
α-helix	296-303	8

Chain B: 16 helices, 11 β-strands

Element	Residues	Length	Sheet
α-helix	3-16	14
α-helix	22-35	14
α-helix	43-59	17
α-helix	63-76	14
α-helix	86-104	19
α-helix	108-115	8
α-helix	116-118	3
β-strand	123-126	4	24
α-helix	132-142	11
β-strand	148-153	6	24
α-helix	160-169	10
β-strand	175-178	4	24
α-helix	183-186	4
α-helix	187-189	3
β-strand	192-195	4	24
β-strand	200	1	25
β-strand	206-209	4	25
α-helix	212-221	10
β-strand	226-229	4	24
α-helix	232-234	3
β-strand	235	1	25
α-helix	248-251	4
β-strand	273-276	4	25
α-helix	278-280	3
β-strand	283-286	4	24
β-strand	289-291	3	24
α-helix	293-303	11

Chain C: 20 helices, 12 β-strands

Element	Residues	Length	Sheet
α-helix	7-23	17
α-helix	31-47	17
α-helix	54-71	18
α-helix	77-97	21
α-helix	129-145	17
α-helix	148-152	5
α-helix	155-157	3
β-strand	164-168	5	29
α-helix	172-181	10
β-strand	188-192	5	29
α-helix	200-209	10
β-strand	213-217	5	29
α-helix	219-221	3
α-helix	222-225	4
α-helix	226-228	3
β-strand	231-234	4	29
β-strand	238-239	2	43
β-strand	245-248	4	43
α-helix	251-260	10
β-strand	265-268	4	29
α-helix	271-273	3
β-strand	274	1	43
α-helix	291-293	3
α-helix	297-302	6
β-strand	306-308	3	26
β-strand	313-316	4	43
α-helix	318-320	3
β-strand	323-325	3	29
β-strand	330-331	2	29
α-helix	333-335	3
α-helix	336-341	6
α-helix	346-349	4

Chain D: 18 helices, 14 β-strands

Element	Residues	Length	Sheet
α-helix	9-23	15
α-helix	31-47	17
α-helix	54-71	18
α-helix	77-96	20
α-helix	129-145	17
α-helix	148-152	5
α-helix	155-157	3
β-strand	164-168	5	20
α-helix	172-181	10
β-strand	188-192	5	20
α-helix	200-209	10
β-strand	213-217	5	20
α-helix	219-221	3
α-helix	222-225	4
α-helix	226-228	3
β-strand	231-234	4	20
β-strand	238-239	2	21
β-strand	245-248	4	21
α-helix	251-261	11
β-strand	265-268	4	20
α-helix	271-273	3
β-strand	274	1	21
β-strand	288	1	22
α-helix	291-293	3
β-strand	306-308	3	23
β-strand	311	1	22
β-strand	313-316	4	21
α-helix	318-320	3
β-strand	323-325	3	20
β-strand	330-331	2	20
α-helix	336-341	6
α-helix	346-349	4

Chain E: 13 helices, 31 β-strands

Element	Residues	Length	Sheet
β-strand	3-8	6	30
α-helix	16-18	3
α-helix	25-27	3
α-helix	37-46	10
β-strand	52-55	4	30
α-helix	57-60	4
β-strand	76-77	2	30
α-helix	87-92	6
α-helix	94-96	3
β-strand	100-103	4	30
β-strand	108	1	31
α-helix	115-124	10
β-strand	128-134	7	30
β-strand	156-161	6	32
β-strand	166	1	30
β-strand	167-172	6	32
β-strand	179-182	4	33
β-strand	192-196	5	32
β-strand	199-201	3	30
β-strand	206-207	2	30
α-helix	209-216	8
α-helix	224-228	5
α-helix	229-235	7
α-helix	263-266	4
β-strand	301-305	5	30
β-strand	312	1	31
α-helix	316-321	6
α-helix	326-333	8
β-strand	344-345	2	34
β-strand	352	1	35
β-strand	357	1	36
β-strand	362-363	2	34
β-strand	368-371	4	35
β-strand	374-375	2	36
β-strand	380	1	34
β-strand	385-388	4	35
β-strand	391-392	2	36
β-strand	397-398	2	34
β-strand	403-405	3	35
β-strand	409	1	36
β-strand	414-415	2	34
β-strand	420-422	3	35
β-strand	426	1	36
β-strand	432	1	34

Chain F: 10 helices, 32 β-strands

Element	Residues	Length	Sheet
β-strand	3-8	6	1
β-strand	29-30	2	2
β-strand	33-34	2	2
α-helix	37-46	10
β-strand	51-55	5	1
α-helix	57-63	7
β-strand	74-77	4	1
α-helix	86-92	7
α-helix	94-96	3
β-strand	100-105	6	1
β-strand	108-110	3	3
α-helix	115-123	9
β-strand	128-134	7	4
β-strand	156-160	5	5
β-strand	166	1	4
β-strand	167-172	6	5
β-strand	179-183	5	6
β-strand	192-193	2	7
β-strand	194-196	3	5
β-strand	199-202	4	4
α-helix	209-216	8
α-helix	224-228	5
α-helix	229-235	7
α-helix	263-266	4
β-strand	300-305	6	4
β-strand	310-312	3	3
α-helix	317-333	17
β-strand	340	1	8
β-strand	357	1	9
β-strand	358	1	8
β-strand	363	1	10
β-strand	370-371	2	11
β-strand	374	1	9
β-strand	380	1	10
β-strand	386-388	3	11
β-strand	391	1	12
β-strand	396-397	2	10
β-strand	403-405	3	11
β-strand	408	1	12
β-strand	413-414	2	10
β-strand	420-422	3	11
β-strand	431	1	10

Chain G: 18 helices, 14 β-strands

Element	Residues	Length	Sheet
α-helix	205-216	12
α-helix	224-238	15
α-helix	248-266	19
α-helix	271-286	16
α-helix	293-308	16
α-helix	309-313	5
α-helix	314-323	10
α-helix	324-326	3
β-strand	332-336	5	26
α-helix	340-351	12
β-strand	357-362	6	26
α-helix	369-379	11
β-strand	383-387	5	26
α-helix	388-390	3
α-helix	391-394	4
β-strand	400-403	4	26
β-strand	407-408	2	27
β-strand	414-417	4	27
α-helix	420-429	10
β-strand	434-437	4	26
α-helix	440-442	3
β-strand	443	1	27
α-helix	460-463	4
β-strand	467	1	28
β-strand	470	1	28
α-helix	476-478	3
β-strand	482-484	3	29
β-strand	489-492	4	27
β-strand	499-502	4	26
β-strand	505-507	3	26
α-helix	509-511	3
α-helix	512-516	5

Chain H: 18 helices, 12 β-strands

Element	Residues	Length	Sheet
α-helix	193-195	3
α-helix	205-214	10
α-helix	224-238	15
α-helix	248-266	19
α-helix	271-286	16
α-helix	293-308	16
α-helix	309-313	5
α-helix	314-323	10
α-helix	324-326	3
β-strand	332-336	5	23
α-helix	340-351	12
β-strand	357-362	6	23
α-helix	369-379	11
β-strand	383-387	5	23
α-helix	388-390	3
α-helix	391-394	4
β-strand	400-403	4	23
β-strand	407-408	2	46
β-strand	414-417	4	46
α-helix	420-429	10
β-strand	434-437	4	23
β-strand	443	1	46
α-helix	460-463	4
β-strand	483-484	2	20
β-strand	489-492	4	46
α-helix	494-496	3
β-strand	499-502	4	23
β-strand	505-507	3	23
α-helix	509-511	3
α-helix	512-517	6

4 more chain groups are not listed. Open the entry in the viewer and use the sequence panel to see them.

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Translation initiation factor eIF-2B subunit gamma	E, F	protein	452	Homo sapiens	Q9NR50 (AlphaFold model)
Eukaryotic translation initiation factor 2 subunit 1	K, L	protein	315	Homo sapiens	P05198 (AlphaFold model)
Translation initiation factor eIF2B subunit epsilon	I, J	protein	721	Homo sapiens	Q13144 (AlphaFold model)
Translation initiation factor eIF2B subunit beta	C, D	protein	351	Homo sapiens	P49770 (AlphaFold model)
Translation initiation factor eIF-2B subunit alpha	A, B	protein	305	Homo sapiens	Q14232
Translation initiation factor eIF-2B subunit delta	G, H	protein	523	Homo sapiens	Q9UI10

Sequence of entity 1 (E, F), FASTA

>9HVD_1 Translation initiation factor eIF-2B subunit gamma (chains E, F)
MEFQAVVMAVGGGSRMTDLTSSIPKPLLPVGNKPLIWYPLNLLERVGFEEVIVVTTRDVQ
KALCAEFKMKMKPDIVCIPDDADMGTADSLRYIYPKLKTDVLVLSCDLITDVALHEVVDL
FRAYDASLAMLMRKGQDSIEPVPGQKGKKKAVEQRDFIGVDSTGKRLLFMANEADLDEEL
VIKGSILQKHPRIRFHTGLVDAHLYCLKKYIVDFLMENGSITSIRSELIPYLVRKQFSSA
SSQQGQEEKEEDLKKKELKSLDIYSFIKEANTLNLAPYDACWNACRGDRWEDLSRSQVRC
YVHIMKEGLCSRVSTLGLYMEANRQVPKLLSALCPEEPPVHSSAQIVSKHLVGVDSLIGP
ETQIGEKSSIKRSVIGSSCLIKDRVTITNCLLMNSVTVEEGSNIQGSVICNNAVIEKGAD
IKDCLIGSGQRIEAKAKRVNEVIVGNDQLMEI

Sequence of entity 2 (K, L), FASTA

>9HVD_2 Eukaryotic translation initiation factor 2 subunit 1 (chains K, L)
MPGLSCRFYQHKFPEVEDVVMVNVRSIAEMGAYVSLLEYNNIEGMILLSELSRRRIRSIN
KLIRIGRNECVVVIRVDKEKGYIDLSKRRVSPEEAIKCEDKFTKSKTVYSILRHVAEVLE
YTKDEQLESLFQRTAWVFDDKYKRPGYGAYDAFKHAVSDPSILDSLDLNEDEREVLINNI
NRRLTPQAVKIRADIEVACYGYEGIDAVKEALRAGLNCSTENMPIKINLIAPPRYVMTTT
TLERTEGLSVLSQAMAVIKEKIEEKRGVFNVQMEPKVVTDTDETELARQMERLERENAEV
DGDDDAEEMEAKAED

Sequence of entity 3 (I, J), FASTA

>9HVD_3 Translation initiation factor eIF2B subunit epsilon (chains I, J)
MAAPVVAPPGVVVSRANKRSGAGPGGSGGGGARGAEEEPPPPLQAVLVADSFDRRFFPIS
KDQPRVLLPLANVALIDYTLEFLTATGVQETFVFCCWKAAQIKEHLLKSKWCRPTSLNVV
RIITSELYRSLGDVLRDVDAKALVRSDFLLVYGDVISNINITRALEEHRLRRKLEKNVSV
MTMIFKESSPSHPTRCHEDNVVVAVDSTTNRVLHFQKTQGLRRFAFPLSLFQGSSDGVEV
RYDLLDCHISICSPQVAQLFTDNFDYQTRDDFVRGLLVNEEILGNQIHMHVTAKEYGARV
SNLHMYSAVCADVIRRWVYPLTPEANFTDSTTQSCTHSRHNIYRGPEVSLGHGSILEENV
LLGSGTVIGSNCFITNSVIGPGCHIGDNVVLDQTYLWQGVRVAAGAQIHQSLLCDNAEVK
ERVTLKPRSVLTSQVVVGPNITLPEGSVISLHPPDAEEDEDDGEFSDDSGADQEKDKVKM
KGYNPAEVGAAGKGYLWKAAGMNMEEEEELQQNLWGLKINMEEESESESEQSMDSEEPDS
RGGSPQMDDIKVFQNEVLGTLQRGKEENISCDNLVLEINSLKYAYNISLKEVMQVLSHVV
LEFPLQQMDSPLDSSRYCALLLPLLKAWSPVFRNYIKRAADHLEALAAIEDFFLEHEALG
ISMAKVLMAFYQLEILAEETILSWFSQRDTTDKGQQLRKNQQLQRFIQWLKEAEEESSED
D

Sequence of entity 4 (C, D), FASTA

>9HVD_4 Translation initiation factor eIF2B subunit beta (chains C, D)
MPGSAAKGSELSERIESFVETLKRGGGPRSSEEMARETLGLLRQIITDHRWSNAGELMEL
IRREGRRMTAAQPSETTVGNMVRRVLKIIREEYGRLHGRSDESDQQESLHKLLTSGGLNE
DFSFHYAQLQSNIIEAINELLVELEGTMENIAAQALEHIHSNEVIMTIGFSRTVEAFLKE
AARKRKFHVIVAECAPFCQGHEMAVNLSKAGIETTVMTDAAIFAVMSRVNKVIIGTKTIL
ANGALRAVTGTHTLALAAKHHSTPLIVCAPMFKLSPQFPNEEDSFHKFVAPEEVLPFTEG
DILEKVSVHCPVFDYVPPELITLFISNIGGNAPSYIYRLMSELYHPDDHVL

Sequence of entity 5 (A, B), FASTA

>9HVD_5 Translation initiation factor eIF-2B subunit alpha (chains A, B)
MDDKELIEYFKSQMKEDPDMASAVAAIRTLLEFLKRDKGETIQGLRANLTSAIETLCGVD
SSVAVSSGGELFLRFISLASLEYSDYSKCKKIMIERGELFLRRISLSRNKIADLCHTFIK
DGATILTHAYSRVVLRVLEAAVAAKKRFSVYVTESQPDLSGKKMAKALCHLNVPVTVVLD
AAVGYIMEKADLVIVGAEGVVENGGIINKIGTNQMAVCAKAQNKPFYVVAESFKFVRLFP
LNQQDVPDKFKYKADTLKVAQTGQDLKEEHPWVDYTAPSLITLLFTDLGVLTPSAVSDEL
IKLYL

Sequence of entity 6 (G, H), FASTA

>9HVD_6 Translation initiation factor eIF-2B subunit delta (chains G, H)
MAAVAVAVREDSGSGMKAELPPGPGAVGREMTKEEKLQLRKEKKQQKKKRKEEKGAEPET
GSAVSAAQCQVGPTRELPESGIQLGTPREKVPAGRSKAELRAERRAKQEAERALKQARKG
EQGGPPPKASPSTAGETPSGVKRLPEYPQVDDLLLRRLVKKPERQQVPTRKDYGSKVSLF
SHLPQYSRQNSLTQFMSIPSSVIHPAMVRLGLQYSQGLVSGSNARCIALLRALQQVIQDY
TTPPNEELSRDLVNKLKPYMSFLTQCRPLSASMHNAIKFLNKEITSVGSSKREEEAKSEL
RAAIDRYVQEKIVLAAQAISRFAYQKISNGDVILVYGCSSLVSRILQEAWTEGRRFRVVV
VDSRPWLEGRHTLRSLVHAGVPASYLLIPAASYVLPEVSKVLLGAHALLANGSVMSRVGT
AQLALVARAHNVPVLVCCETYKFCERVQTDAFVSNELDDPDDLQCKRGEHVALANWQNHA
SLRLLNLVYDVTPPELVDLVITELGMIPCSSVPVVLRVKSSDQ

Primary citation

Termination of the integrated stress response. De Miguel, C., Thorkelsson, S.R., Fatalska, A. et al. Science (2026) 391:eadw5137-eadw5137. DOI 10.1126/science.adw5137 · PubMed

Other PDB entries of the same protein (UniProt Q9NR50 (AlphaFold model), which also has an AlphaFold model), best resolution first:

9Y4B 2.1 Å, Eukaryotic translation initiation factor 2-B (eIF2B) with a truncation in the beta…
7VLK 2.27 Å, eIF2B-SFSV NSs C2-imposed
9Y3U 2.4 Å, Eukaryotic translation initiation factor 2-B (eIF2B) with a truncation in the beta…
9Y4W 2.4 Å, Eukaryotic translation initiation factor 2-B (eIF2B) with a truncation in the beta…
7F64 2.42 Å, eIF2B-SFSV NSs
9Y3T 2.5 Å, Eukaryotic translation initiation factor 2-B (eIF2B) with a truncation in the beta…
7RLO 2.6 Å, Structure of the human eukaryotic translation initiation factor 2B (eIF2B) in complex…
9HVE 2.7 Å, Native human eIF2-eIF2B complex
7F66 2.76 Å, eIF2B-SFSV NSs-1-eIF2
9Y5T 2.78 Å, eIF2B lacking the latch helix bound to ISRACT-02 (Active state)
6CAJ 2.8 Å, Electron cryo-microscopy of the eukaryotic translation initiation factor 2B from Homo…
7L70 2.8 Å, The eukaryotic translation initiation factor 2B from Homo sapiens in its apo form

Browse structure collections

About this viewer

MolViewer shows 9HVD directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.