9I3E: CP of RHDV mutant - 29N

CP of RHDV mutant - 29N. Determined by electron microscopy at 3.0 Å resolution. Released 26 Nov 2025.

Method: Electron microscopy
Resolution: 3.0 Å
Organism: Rabbit hemorrhagic disease virus
Chains: 1
Atoms: 1,329
Mol. weight: 18.82 kDa
Released: 26 Nov 2025

Explore 9I3E in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

9I3E contains 3 α-helices and 14 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain 0: 3 helices, 14 β-strands

Element	Residues	Length	Sheet
β-strand	66	1	1
β-strand	68	1	1
β-strand	71	1	1
β-strand	73-81	9	2
β-strand	89-94	6	3
α-helix	101-109	9
β-strand	110-114	5	4
β-strand	117-124	8	2
β-strand	130-138	9	3
α-helix	139	1
β-strand	155-159	5	3
α-helix	165	1
β-strand	166-170	5	2
β-strand	179	1	4
β-strand	189-199	11	3
β-strand	208-217	10	2
β-strand	222-226	5	4

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Capsid protein VP60	0	protein	174	Rabbit hemorrhagic disease virus	Q86119

Sequence of entity 1 (0), FASTA

>9I3E_1 Capsid protein VP60 (chains 0)
GGPPQQVDQQETWRTNFYYNDVFTWSVADAPGSILYTVQHSPQNNPFTAVLSQMYAGWAG
GMQFRFAVAGSGAFGGRVAAAVIPPGIEIGPGLEVRQFPHVVIDARSLEPVTNTMPDLRP
NMYHPTGDPGLVPTLVLAVYNALINPFGGSTSAIQVTVETRPSEDFEFVMIRAP

Primary citation

Structure of RHDV mutant 29N at 3.0 Angstroms resolution. Novoa, G., Martinez-Romero, J.M., Perez-Mata, C. et al. To be published.

Other PDB entries of the same protein (UniProt Q86119), best resolution first:

8CYL 1.89 Å, Ast89 P domain
9I3H 2.5 Å, CP of RHDV mutant - N15
9I8J 2.9 Å, AB Spike of RHDV mutant N15
9I90 3.2 Å, CP of empty RHDV virion
9I8R 3.3 Å, CP of RHDV VLP (VP1)
9I9D 3.3 Å, CP of RHDV virion (full particle)
3ZUE 10.3 Å, Rabbit Hemorrhagic Disease Virus (RHDV)capsid protein

Browse structure collections

About this viewer

MolViewer shows 9I3E directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.