9I6D: Glutamate transporter homolog

Glutamate transporter homologue GltPh mutant P206R in Complex with L-Aspartate and Sodium Ions in Salipro. Determined by electron microscopy at 3.34 Å resolution. Released 18 Feb 2026.

Method: Electron microscopy
Resolution: 3.34 Å
Organism: Pyrococcus horikoshii
Chains: 3
Atoms: 9,387
Mol. weight: 140.48 kDa
Ligands: D3D, PGM, PG8, ASP
Released: 18 Feb 2026

Explore 9I6D in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

9I6D contains 75 α-helices and 0 β-strands across 3 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chains A, B and C: 25 helices, 0 β-strands

Element	Residues	Length
α-helix	13-33	21
α-helix	38-42	5
α-helix	44-55	12
α-helix	58-70	13
α-helix	75-77	3
α-helix	80-106	27
α-helix	121-123	3
α-helix	127-129	3
α-helix	130-135	6
α-helix	142-148	7
α-helix	152-169	18
α-helix	174-219	46
α-helix	223-241	19
α-helix	242-246	5
α-helix	247-253	7
α-helix	258-264	7
α-helix	266-275	10
α-helix	282-291	10
α-helix	296-308	13
α-helix	312-328	17
α-helix	332-334	3
α-helix	335-350	16
α-helix	358-369	12
α-helix	377-388	12
α-helix	390-418	29

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Glutamate transporter homolog	A, B, C	protein	425	Pyrococcus horikoshii	O59010 (AlphaFold model)

Sequence of entity 1 (A, B, C), FASTA

>9I6D_1 Glutamate transporter homolog (chains A, B, C)
MGLYRKYIEYPVLQKILIGLILGAIVGLILGHYGYADAVKTYVKPFGDLFVRLLKMLVMP
IVFASLVVGAASISPARLGRVGVKIVVYYLLTSAFAVTLGIIMARLFNPGAGIHLAVGGQ
QFQPKQAPPLVKILLDIVPTNPFGALANGQVLPTIFFAIILGIAITYLMNSENEKVRKSA
ETLLDAINGLAEAMYKIVNGVMQYARIGVFALIAYVMAEQGVKVVGELAKVTAAVYVGLT
LQILLVYFVLLKIYGIDPISFIKKAKDAMLTAFVTRSSSGTLPVTMRVAKEMGISEGIYS
FTLPLGATINMDGTALYQGVCTFFIANALGSHLTVGQQLTIVLTAVLASIGTAGVPGAGA
IMLAMVLESVGLPLTDPNVAAAYAMILGIDAILDMGRTMVNVTGDLTGTAIVAKTEGTLE
KGVIA

Ligands and cofactors

ID	Name	Formula	Copies
D3D	(19S,22R,25R)-22,25,26-trihydroxy-16,22-dioxo-17,21,23-trioxa-22lambda~5~-phosp…	C40 H77 O10 P	3
PGM	1-myristoyl-2-hydroxy-sn-glycero-3-[phospho-rac-(1-glycerol)]	C22 H44 O9 P	3
PG8	1,2-dioctanoyl-sn-glycero-3-[phospho-rac-(1-glycerol)	C22 H42 O10 P	3
ASP	Aspartic acid	C4 H7 N O4	3

Water and common crystallization additives (CL, NA) are not listed.

Primary citation

CryoEM Structure of Glutamate transporter homologue GltPh mutant P206R in complex with L-Aspartate and Sodium ions in Salipro. Horn, G., Overa, C., Fu, L. et al. To be published.

Other PDB entries of the same protein (UniProt O59010 (AlphaFold model), which also has an AlphaFold model), best resolution first:

7RCP 2.2 Å, GltPh mutant (S279E/D405N) in complex with aspartate and sodium ions
7AHK 2.5 Å, Crystal structure of the outward-facing state of the substrate-free Na+-only bound…
7UG0 2.55 Å, TBOA-bound GltPh RSMR mutant in IFS state
9BH2 2.7 Å, Apo GltPh, outward-facing state
7UGJ 2.81 Å, TBOA-bound GltPh RSMR mutant in OFS state
7UGV 2.94 Å, Asp-bound GltPh RSMR mutant in IFS-A2 state
7UGD 2.95 Å, Asp-bound GltPh RSMR mutant in IFS-A1 state
2NWL 2.96 Å, Crystal structure of GltPh in complex with L-Asp
7UGX 2.96 Å, Asp-bound GltPh RSMR mutant in IFS-B1 state
7UH3 2.99 Å, Asp-bound GltPh RSMR mutant in iOFS state
6X15 3.05 Å, Inward-facing state of the glutamate transporter homologue GltPh in complex with…
6UWF 3.08 Å, GltPh in complex with L-aspartate and sodium ions in outward-facing state

Browse structure collections

About this viewer

MolViewer shows 9I6D directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.