9I8J: AB Spike of RHDV mutant N15

AB Spike of RHDV mutant N15. Determined by electron microscopy at 2.9 Å resolution. Released 3 Dec 2025.

Method: Electron microscopy
Resolution: 2.9 Å
Organism: Rabbit hemorrhagic disease virus
Chains: 2
Atoms: 4,958
Mol. weight: 70.27 kDa
Released: 3 Dec 2025

Explore 9I8J in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

9I8J contains 17 α-helices and 67 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 8 helices, 30 β-strands

Element	Residues	Length	Sheet
α-helix	245-247	3
α-helix	259-260	2
β-strand	261-266	6	1
β-strand	294-297	4	2
β-strand	300	1	3
β-strand	301-303	3	2
β-strand	312	1	4
β-strand	315-319	5	2
β-strand	340	1	2
α-helix	341-342	2
α-helix	348-350	3
β-strand	355-362	8	2
β-strand	368-382	15	2
β-strand	389-390	2	2
β-strand	393	1	5
β-strand	398-403	6	2
β-strand	407	1	4
β-strand	415	1	3
β-strand	416-421	6	2
β-strand	425	1	2
β-strand	426	1	6
β-strand	437	1	1
β-strand	445	1	5
α-helix	450-452	3
β-strand	459-460	2	7
β-strand	461-466	6	1
β-strand	469	1	6
α-helix	482-484	3
β-strand	485-488	4	1
α-helix	492-499	8
β-strand	511-518	8	7
β-strand	523-528	6	7
β-strand	534-536	3	7
β-strand	545-546	2	1
β-strand	552	1	7
β-strand	555-560	6	7
α-helix	564-566	3
β-strand	567-568	2	7

Chain B: 9 helices, 37 β-strands

Element	Residues	Length	Sheet
α-helix	236-238	3
α-helix	245-248	4
β-strand	261-266	6	8
α-helix	267	1
β-strand	278	1	9
β-strand	284	1	9
β-strand	294-296	3	10
β-strand	300	1	11
β-strand	301-303	3	10
β-strand	312	1	12
β-strand	315-319	5	10
β-strand	339	1	13
β-strand	340	1	10
α-helix	349-350	2
β-strand	354-362	9	10
α-helix	367	1
β-strand	368-382	15	10
β-strand	389-390	2	10
β-strand	393	1	14
β-strand	398-403	6	10
β-strand	407	1	12
β-strand	415	1	11
β-strand	416-421	6	10
β-strand	425	1	10
β-strand	426	1	15
β-strand	437	1	8
β-strand	443	1	13
β-strand	445	1	14
β-strand	455	1	16
β-strand	458	1	16
β-strand	459-460	2	17
β-strand	461-466	6	8
β-strand	469	1	15
α-helix	482-484	3
β-strand	485-488	4	8
α-helix	492-498	7
β-strand	509	1	17
β-strand	511-518	8	17
β-strand	523-524	2	17
β-strand	526-528	3	17
β-strand	534-536	3	17
α-helix	543-544	2
β-strand	545-546	2	8
β-strand	552-560	9	17
α-helix	564-566	3
β-strand	567-568	2	17

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Capsid protein VP60	A, B	protein	340	Rabbit hemorrhagic disease virus	Q86119

Sequence of entity 1 (A, B), FASTA

>9I8J_1 Capsid protein VP60 (chains A, B)
KTVDSISPAGLLTTPVLTGVGNDNRWNGQIVGLQPVPGGFSTCNRHWNLNGSTYGWSSPR
FADIDHRRGSASYPGNNATNVLQFWYANAGSAIDNPISQVAPDGFPDMSFVPFNGPGIPA
AGWVGFGAIWNSNSGAPNVTTVQAYELGFATGAPGNLQPTTNTSGSQTVAKSIYAVVTGT
AQNPAGLFVMASGVISTPSANAITYTPQPDRIVTTPGTPAAAPVGKNTPIMFASVVRRTG
DVNATAGSANGTQYGTGSQPLPVTIGLSLNNYSSALMPGQFFVWQLTFASGFMEIGLSVD
GYFYAGTGASTTLIDLTELIDVRPVGPRPSKSTLVFNLGG

Primary citation

AB Spike of RHDV mutant N15. Novoa, G., Martinez-Romero, J.M., Perez-Mata, C. et al. To be published.

Other PDB entries of the same protein (UniProt Q86119), best resolution first:

8CYL 1.89 Å, Ast89 P domain
9I3H 2.5 Å, CP of RHDV mutant - N15
9I3E 3.0 Å, CP of RHDV mutant - 29N
9I90 3.2 Å, CP of empty RHDV virion
9I8R 3.3 Å, CP of RHDV VLP (VP1)
9I9D 3.3 Å, CP of RHDV virion (full particle)
3ZUE 10.3 Å, Rabbit Hemorrhagic Disease Virus (RHDV)capsid protein

Browse structure collections

About this viewer

MolViewer shows 9I8J directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.