Crystal Structure of human BCL-2 (R129L) mutant in complex with a stapled BAD BH3 peptide BAD SAHB 4.2. Determined by X-ray diffraction at 1.73 Å resolution. Released 8 Oct 2025.
Explore 9O16 in 3D Show helices and sheets RCSB PDB PDBe
9O16 contains 11 α-helices and 0 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 11-24 | 14 | |
| α-helix | 93-107 | 15 | |
| α-helix | 109-119 | 11 | |
| α-helix | 126-137 | 12 | |
| α-helix | 144-163 | 20 | |
| α-helix | 168-180 | 13 | |
| α-helix | 181-185 | 5 | |
| α-helix | 186-191 | 6 | |
| α-helix | 194-202 | 9 | |
| α-helix | 203-205 | 3 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 304-321 | 18 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Apoptosis regulator Bcl-2,Bcl-2-like protein 1 | A | protein | 166 | Homo sapiens | P10415 (AlphaFold model), Q07817 (AlphaFold model) |
| stapled BAD BH3 peptide BAD SAHB 4.2 | B | protein | 23 | Homo sapiens | Q92934 (AlphaFold model) |
>9O16_1 Apoptosis regulator Bcl-2,Bcl-2-like protein 1 (chains A) MAHAGRTGYDNREIVMKYIHYKLSQRGYEWDAGDDVEENRTEAPEGTESEVVHLTLRQAG DDFSRRYRRDFAEMSSQLHLTPFTARGLFATVVEELFRDGVNWGRIVAFFEFGGVMCVES VNREMSPLVDNIALWMTEYLNRHLHTWIQDNGGWDAFVELYGPSMR
>9O16_2 stapled BAD BH3 peptide BAD SAHB 4.2 (chains B) XWLAQRLGRELRRLSDEFVDSFK
| ID | Name | Formula | Copies |
|---|---|---|---|
| NI | Nickel (II) ion | Ni | 3 |
Water and common crystallization additives (SO4, IMD) are not listed.
Structural insights into chemoresistance mutants of BCL-2 and their targeting by stapled BAD BH3 helices. DeAngelo, T.M., Adhikary, U., Korshavn, K.J. et al. Nat Commun (2025) 16:8623-8623. DOI 10.1038/s41467-025-63657-y · PubMed
Other PDB entries of the same protein (UniProt P10415 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 9O16 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.