9IQP: Wuhan SARS-CoV-2 Spike RBD

Crystal structure of the Wuhan SARS-CoV-2 Spike RBD (319-541) complexed with 1p1B10 nanobody. Determined by X-ray diffraction at 1.55 Å resolution. Released 16 Jul 2025.

Method: X-ray diffraction
Resolution: 1.55 Å
Organisms: Severe acute respiratory syndrome coronavirus 2, Camelus bactrianus
Chains: 2
Atoms: 2,967
Mol. weight: 43.24 kDa
Ligands: NAG
Released: 16 Jul 2025

Explore 9IQP in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

9IQP contains 14 α-helices and 33 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 12 helices, 17 β-strands

Element	Residues	Length	Sheet
β-strand	335	1	1
α-helix	336	1
α-helix	339-342	4
α-helix	347-348	2
β-strand	349	1	2
α-helix	350-352	3
β-strand	354-358	5	2
β-strand	361-362	2	1
α-helix	365-369	5
β-strand	376-380	5	2
α-helix	384-389	6
β-strand	391-392	2	1
β-strand	394-403	10	2
α-helix	404-409	6
α-helix	417-421	5
β-strand	431-437	7	2
α-helix	439-442	4
β-strand	448	1	3
β-strand	452-454	3	4
α-helix	460-462	3
α-helix	471-472	2
β-strand	473-474	2	5
β-strand	485	1	5
β-strand	488-489	2	5
β-strand	492-494	3	4
β-strand	497	1	3
α-helix	503-505	3
β-strand	507-516	10	2
β-strand	524-525	2	1

Chain B: 2 helices, 16 β-strands

Element	Residues	Length	Sheet
β-strand	3-7	5	6
β-strand	10-13	4	7
β-strand	18-25	8	6
β-strand	34-40	7	7
β-strand	44-51	8	7
β-strand	57-59	3	7
α-helix	61-63	3
β-strand	64	1	6
β-strand	67-72	6	6
β-strand	77-82	6	6
α-helix	87-89	3
β-strand	91-98	8	7
β-strand	101	1	8
β-strand	104	1	8
β-strand	107-108	2	9
β-strand	111-112	2	9
β-strand	113-115	3	7
β-strand	119-124	6	7

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Spike protein S1	A	protein	235	Severe acute respiratory syndrome coronavirus 2	P0DTC2 (AlphaFold model)
Nanobody 1p1B10	B	protein	150	Camelus bactrianus

Sequence of entity 1 (A), FASTA

>9IQP_1 Spike protein S1 (chains A)
RVQPTESIVRFPNITNLCPFGEVFNATRFASVYAWNRKRISNCVADYSVLYNSASFSTFK
CYGVSPTKLNDLCFTNVYADSFVIRGDEVRQIAPGQTGKIADYNYKLPDDFTGCVIAWNS
NNLDSKVGGNYNYLYRLFRKSNLKPFERDISTEIYQAGSTPCNGVEGFNCYFPLQSYGFQ
PTNGVGYQPYRVVVLSFELLHAPATVCGPKKSTNLVKNKCVNFGSHHHHHHHHHH

Sequence of entity 2 (B), FASTA

>9IQP_2 Nanobody 1p1B10 (chains B)
QVQLQESGGGSVQAGGSLRLSCTPSGFTVHDSDMGWYRVKPGNECELVTTLFGDGDTYYA
DSVKDRFIISQDNAKNTVYLQMNNLKPEDTAKYHCVARGVGVYGMHWFCGEYNFAGQGTQ
VTVSSAAAEQKLISEEDLNGAAHHHHHHGS

Ligands and cofactors

ID	Name	Formula	Copies
NAG	2-acetamido-2-deoxy-beta-D-glucopyranose	C8 H15 N O6	1

Water and common crystallization additives (NA) are not listed.

Primary citation

Ultra-potent RBM-specific single-domain antibody broadly neutralizes multiple SARS-CoV-2 variants with picomolar activity. Shcheblyakov, D.V., Favorskaya, I.A., Dolzhikova, I.V. et al. Int J Biol Macromol (2025) 319:145386-145386. DOI 10.1016/j.ijbiomac.2025.145386 · PubMed

Other PDB entries of the same protein (UniProt P0DTC2 (AlphaFold model), which also has an AlphaFold model), best resolution first:

7Z8O 0.96 Å, Crystal structure of SARS-CoV-2 S RBD in complex with a stapled peptide
7Y8J 1.03 Å, 3D1 in complex with 6-mer HR1 peptide from SARS-CoV-2
9FC2 1.21 Å, The crystal structure of the SARS-CoV-2 receptor binding domain in complex with the…
7EK6 1.24 Å, Structure of viral peptides IPB19/N52
7EAM 1.4 Å, immune complex of SARS-CoV-2 RBD and cross-neutralizing antibody 7D6
7M53 1.4 Å, B6 Fab fragment bound to the SARS-CoV/SARS-CoV-2 spike stem helix peptide
8CMC 1.42 Å, Human Leukocyte Antigen class II allotype DR1 presenting SARS-CoV-2 Spike peptide S511-530
7M8U 1.45 Å, Crystal Structure of HLA-B*35:01 in complex with IPFAMQMAY, an 9-mer epitope from…
7ZR2 1.45 Å, Crystal structure of a chimeric protein mimic of SARS-CoV-2 Spike HR1 in complex with HR2
8D36 1.45 Å, Crystal structure of SARS-CoV-2 fusion peptide in complex with neutralizing antibody…
8ENS 1.45 Å, Crystal structure of beta'-COPI-WD40 domain in complex with SARS-CoV-2 spike tail…
8ENW 1.45 Å, Crystal structure of beta'-COPI-WD40 domain in complex with SARS-CoV-2 clientized spike…

Browse structure collections

About this viewer

MolViewer shows 9IQP directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.