9IVS: CHIKV nsP3 peptide
Cryo-EM structure of the CHIKV nsP3 peptide in complex with the NTF2L domain of G3BP1 (Conformation III). Determined by electron microscopy at 2.97 Å resolution. Released 9 Apr 2025.
- Method
- Electron microscopy
- Resolution
- 2.97 Å
- Organisms
- Homo sapiens, Chikungunya virus
- Chains
- 24
- Atoms
- 19,758
- Mol. weight
- 304.92 kDa
- Released
- 9 Apr 2025
Explore 9IVS in 3D
Show helices and sheets
RCSB PDB
PDBe
Secondary structure: helices and β-sheets
9IVS contains 111 α-helices and 127 β-strands across 24 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
Chain A: 6 helices, 6 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 8-25 | 18 | |
| α-helix | 27-32 | 6 | |
| β-strand | 34-40 | 7 | 1 |
| α-helix | 51-54 | 4 | |
| β-strand | 55-56 | 2 | 1 |
| α-helix | 57-68 | 12 | |
| β-strand | 74-85 | 12 | 1 |
| β-strand | 89-99 | 11 | 1 |
| α-helix | 100-102 | 3 | |
| β-strand | 106-116 | 11 | 1 |
| α-helix | 117 | 1 | |
| β-strand | 123-133 | 11 | 1 |
Chain B: 7 helices, 8 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 8-22 | 15 | |
| α-helix | 27-33 | 7 | |
| β-strand | 34-42 | 9 | 5 |
| β-strand | 45 | 1 | 6 |
| α-helix | 50 | 1 | |
| β-strand | 51 | 1 | 6 |
| α-helix | 52-54 | 3 | |
| β-strand | 55-56 | 2 | 5 |
| α-helix | 58-68 | 11 | |
| β-strand | 74-84 | 11 | 5 |
| α-helix | 86-88 | 3 | |
| β-strand | 90-99 | 10 | 5 |
| β-strand | 106-116 | 11 | 5 |
| β-strand | 123-133 | 11 | 5 |
| α-helix | 134-137 | 4 | |
Chain C: 4 helices, 8 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 8-25 | 18 | |
| α-helix | 27-33 | 7 | |
| β-strand | 34-41 | 8 | 2 |
| β-strand | 45 | 1 | 3 |
| β-strand | 51 | 1 | 3 |
| β-strand | 55-56 | 2 | 2 |
| α-helix | 59-67 | 9 | |
| β-strand | 74-85 | 12 | 2 |
| β-strand | 89-99 | 11 | 2 |
| β-strand | 106-116 | 11 | 2 |
| β-strand | 123-133 | 11 | 2 |
| α-helix | 134-137 | 4 | |
Chain D: 4 helices, 6 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 8-25 | 18 | |
| α-helix | 28-33 | 6 | |
| β-strand | 39-42 | 4 | 4 |
| β-strand | 55-56 | 2 | 4 |
| α-helix | 57-68 | 12 | |
| β-strand | 74-84 | 11 | 4 |
| β-strand | 90-99 | 10 | 4 |
| β-strand | 106-116 | 11 | 4 |
| β-strand | 123-133 | 11 | 4 |
| α-helix | 134-136 | 3 | |
Chain E: 3 helices, 6 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 8-25 | 18 | |
| α-helix | 27-32 | 6 | |
| β-strand | 39-40 | 2 | 20 |
| β-strand | 55-56 | 2 | 20 |
| α-helix | 57-68 | 12 | |
| β-strand | 74-85 | 12 | 20 |
| β-strand | 89-99 | 11 | 20 |
| β-strand | 106-116 | 11 | 20 |
| β-strand | 124-133 | 10 | 20 |
Chain F: 7 helices, 8 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 8-24 | 17 | |
| α-helix | 27-33 | 7 | |
| β-strand | 34-42 | 9 | 23 |
| β-strand | 45 | 1 | 24 |
| α-helix | 50 | 1 | |
| β-strand | 51 | 1 | 24 |
| α-helix | 52-54 | 3 | |
| β-strand | 55-56 | 2 | 23 |
| α-helix | 58-68 | 11 | |
| β-strand | 74-84 | 11 | 23 |
| α-helix | 86-88 | 3 | |
| β-strand | 90-99 | 10 | 23 |
| β-strand | 106-116 | 11 | 23 |
| β-strand | 123-133 | 11 | 23 |
| α-helix | 134-137 | 4 | |
Chains G and R: 5 helices, 8 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 8-25 | 18 | |
| α-helix | 27-33 | 7 | |
| β-strand | 34-42 | 9 | 21 |
| β-strand | 45 | 1 | 22 |
| β-strand | 51 | 1 | 22 |
| α-helix | 52 | 1 | |
| β-strand | 55-56 | 2 | 21 |
| α-helix | 59-67 | 9 | |
| β-strand | 74-84 | 11 | 21 |
| α-helix | 86-88 | 3 | |
| β-strand | 90-99 | 10 | 21 |
| β-strand | 106-116 | 11 | 21 |
| β-strand | 123-133 | 11 | 21 |
Chain H: 3 helices, 6 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 8-25 | 18 | |
| α-helix | 27-33 | 7 | |
| β-strand | 39-42 | 4 | 7 |
| β-strand | 55-56 | 2 | 7 |
| α-helix | 58-68 | 11 | |
| β-strand | 74-85 | 12 | 7 |
| β-strand | 89-99 | 11 | 7 |
| β-strand | 106-116 | 11 | 7 |
| β-strand | 123-133 | 11 | 7 |
15 more chain groups are not listed. Open the entry in the viewer and use the sequence panel to see them.
Molecules and chains
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|
| Ras GTPase-activating protein-binding protein 1 | A, B, C, D, E, F, G, H, M, N, O, P, Q, R, S, T | protein | 141 | Homo sapiens | Q13283 (AlphaFold model) |
| Polyprotein P1234 | I, J, K, L, U, V, W, X | protein | 54 | Chikungunya virus | A0A0U5KFN5 |
Sequence of entity 1 (A, B, C, D, E, F, G, H, M, N, O, P, Q, R, S, T), FASTA
>9IVS_1 Ras GTPase-activating protein-binding protein 1 (chains A, B, C, D, E, F, G, H, M, N, O, P, Q, R, S, T)
GASMVMEKPSPLLVGREFVRQYYTLLNQAPDMLHRFYGKNSSYVHGGLDSNGKPADAVYG
QKEIHRKVMSQNFTNCHTKIRHVDAHATLNDGVVVQVMGLLSNNNQALRRFMQTFVLAPE
GSVANKFYVHNDIFRYQDEVF
Sequence of entity 2 (I, J, K, L, U, V, W, X), FASTA
>9IVS_2 Polyprotein P1234 (chains I, J, K, L, U, V, W, X)
GPLGSETFPITFGDFNDGEIESLSSELLTFGDFLPGEVDDLTDSDWSTHHHHHH
Primary citation
Cryo-EM reveals a double oligomeric ring scaffold of the CHIKV nsP3 peptide in complex with the NTF2L domain of host G3BP1. Liu, Y., Wang, J., Han, Y. et al. mBio (2025) 16:e0396724-e0396724. DOI 10.1128/mbio.03967-24 · PubMed
Other PDB entries of the same protein (UniProt Q13283 (AlphaFold model), which also has an AlphaFold model), best resolution first:
- 4FCJ 1.62 Å, Crystal structure of the NTF2-like domain of human G3BP1
- 3Q90 1.7 Å, Crystal structure of the NTF2 domain of Ras GTPase-activating protein-binding protein 1
- 8TH1 1.8 Å, Crystal Structure of the G3BP1 NTF2-like domain bound to the IDR1 of SARS-CoV-2…
- 5FW5 1.92 Å, Crystal structure of human G3BP1 in complex with Semliki Forest Virus nsP3-25 comprising…
- 6TA7 1.93 Å, Crystal structure of human G3BP1-NTF2 in complex with human CAPRIN1-derived solomon motif
- 8TH6 2.34 Å, Crystal Structure of the G3BP1 NTF2-like domain bound to USP10 peptide
- 7SUO 2.35 Å, Crystal Structure of the G3BP1 NTF2-like domain bound to the IDR1 of SARS-CoV-2…
- 7S17 2.36 Å, Crystal structure of human G3BP1-NTF2 with three mutations- F15W, F33W, and F124W
- 9CC6 2.4 Å, De novo design of high-affinity protein binders to RNA binding domain of G3bp1
- 7XHG 2.46 Å, Crystal structure of the NTF2L domain of human G3BP1 in complex with the Caprin-1…
- 8TH5 2.62 Å, Crystal Structure of the G3BP1 NTF2-like domain bound to the IDR1 of SARS-CoV-2…
- 9IVQ 2.66 Å, Cryo-EM structure of the CHIKV nsP3 peptide in complex with the NTF2L domain of G3BP1…
Browse structure collections
About this viewer
MolViewer shows 9IVS directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.