Cryo-EM structure of the wild-type human serotonin transporter complexed with S-ketamine. Determined by electron microscopy at 3.27 Å resolution. Released 12 Nov 2025.
Explore 9IY7 in 3D Show helices and sheets RCSB PDB PDBe
9IY7 contains 35 α-helices and 6 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 85-96 | 12 | |
| α-helix | 100-111 | 12 | |
| α-helix | 118-124 | 7 | |
| α-helix | 125-129 | 5 | |
| α-helix | 130-143 | 14 | |
| α-helix | 150-152 | 3 | |
| α-helix | 156-159 | 4 | |
| α-helix | 160-189 | 30 | |
| α-helix | 227-231 | 5 | |
| α-helix | 232-236 | 5 | |
| α-helix | 239-241 | 3 | |
| β-strand | 244 | 1 | 1 |
| β-strand | 247 | 1 | 1 |
| β-strand | 251 | 1 | 2 |
| α-helix | 253-270 | 18 | |
| α-helix | 277-284 | 8 | |
| α-helix | 287-300 | 14 | |
| α-helix | 305-310 | 6 | |
| α-helix | 317-321 | 5 | |
| α-helix | 323-337 | 15 | |
| α-helix | 343-349 | 7 | |
| α-helix | 357-389 | 33 | |
| α-helix | 404 | 1 | |
| α-helix | 405-409 | 5 | |
| α-helix | 410-415 | 6 | |
| α-helix | 420-453 | 34 | |
| α-helix | 462-476 | 15 | |
| β-strand | 482 | 1 | 2 |
| α-helix | 485-494 | 10 | |
| α-helix | 499-510 | 12 | |
| α-helix | 511-515 | 5 | |
| α-helix | 518-529 | 12 | |
| α-helix | 535-539 | 5 | |
| α-helix | 540-544 | 5 | |
| α-helix | 546-558 | 13 | |
| β-strand | 564 | 1 | 3 |
| β-strand | 569 | 1 | 3 |
| α-helix | 572-586 | 15 | |
| α-helix | 588-599 | 12 | |
| α-helix | 606-612 | 7 | |
| α-helix | 614-616 | 3 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Sodium-dependent serotonin transporter | A | protein | 636 | Homo sapiens | P31645 (AlphaFold model) |
>9IY7_1 Sodium-dependent serotonin transporter (chains A) METTPLNSQKQLSACEDGEDCQENGVLQKVVPTPGDKVESGQISNGYSAVPSPGAGDDTR HSIPATTTTLVAELHQGERETWGKKVDFLLSVIGYAVDLGNVWRFPYICYQNGGGAFLLP YTIMAIFGGIPLFYMELALGQYHRNGCISIWRKICPIFKGIGYAICIIAFYIASYYNTIM AWALYYLISSFTDQLPWTSCKNSWNTGNCTNYFSEDNITWTLHSTSPAEEFYTRHVLQIH RSKGLQDLGGISWQLALCIMLIFTVIYFSIWKGVKTSGKVVWVTATFPYIILSVLLVRGA TLPGAWRGVLFYLKPNWQKLLETGVWIDAAAQIFFSLGPGFGVLLAFASYNKFNNNCYQD ALVTSVVNCMTSFVSGFVIFTVLGYMAEMRNEDVSEVAKDAGPSLLFITYAEAIANMPAS TFFAIIFFLMLITLGLDSTFAGLEGVITAVLDEFPHVWAKRRERFVLAVVITCFFGSLVT LTFGGAYVVKLLEEYATGPAVLTVALIEAVAVSWFYGITQFCRDVKEMLGFSPGWFWRIC WVAISPLFLLFIICSFLMSPPQLRLFQYNYPYWSIILGYCIGTSSFICIPTYIAYRLIIT PGTFKERIIKSITPETPTEIPCGDIRLNAVLEVLFQ
| ID | Name | Formula | Copies |
|---|---|---|---|
| NAG | 2-acetamido-2-deoxy-beta-D-glucopyranose | C8 H15 N O6 | 1 |
| JC9 | (2~{S})-2-(2-chlorophenyl)-2-(methylamino)cyclohexan-1-one | C13 H16 Cl N O | 1 |
| DD9 | nonane | C9 H20 | 5 |
| OCT | N-octane | C8 H18 | 5 |
| D12 | Dodecane | C12 H26 | 6 |
| LMT | Dodecyl-beta-D-maltoside | C24 H46 O11 | 1 |
| Y01 | Cholesterol hemisuccinate | C31 H50 O4 | 3 |
| D10 | Decane | C10 H22 | 2 |
Water and common crystallization additives (CL, NA) are not listed.
CryoEM structure of a transmembrane protein. Ning, Y., Ge, J. To be published.
Other PDB entries of the same protein (UniProt P31645 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 9IY7 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.