9J5S: Human G3BP1

Crystal structure of human G3BP1 in complex with CHIKV nsP3 peptide. Determined by X-ray diffraction at 2.84 Å resolution. Released 9 Apr 2025.

Method: X-ray diffraction
Resolution: 2.84 Å
Organisms: Homo sapiens, Chikungunya virus
Chains: 4
Atoms: 2,320
Mol. weight: 37.84 kDa
Released: 9 Apr 2025

Explore 9J5S in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

9J5S contains 10 α-helices and 18 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 6 helices, 10 β-strands

Element	Residues	Length	Sheet
α-helix	4-7	4
α-helix	8-25	18
α-helix	27-33	7
β-strand	34	1	1
β-strand	40	1	2
β-strand	41-42	2	1
β-strand	45	1	3
β-strand	51	1	3
α-helix	52	1
β-strand	55	1	2
α-helix	58-67	10
β-strand	74-84	11	1
β-strand	90-99	10	1
α-helix	103-105	3
β-strand	106-116	11	1
β-strand	124-133	10	1

Chain B: 3 helices, 6 β-strands

Element	Residues	Length	Sheet
α-helix	8-25	18
α-helix	27-33	7
β-strand	34-41	8	4
β-strand	55-56	2	4
α-helix	58-67	10
β-strand	74-84	11	4
β-strand	90-99	10	4
β-strand	106-116	11	4
β-strand	123-133	11	4

Chain C: 0 helices, 1 β-strand

Element	Residues	Length	Sheet
β-strand	475	1	1

Chain D: 1 helix, 1 β-strand

Element	Residues	Length	Sheet
β-strand	474-475	2	4
α-helix	478-479	2

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Ras GTPase-activating protein-binding protein 1	A, B	protein	141	Homo sapiens	Q13283 (AlphaFold model)
Polyprotein P1234	C, D	protein	26	Chikungunya virus	A0A0U5KFN5

Sequence of entity 1 (A, B), FASTA

>9J5S_1 Ras GTPase-activating protein-binding protein 1 (chains A, B)
GASMVMEKPSPLLVGREFVRQYYTLLNQAPDMLHRFYGKNSSYVHGGLDSNGKPADAVYG
QKEIHRKVMSQNFTNCHTKIRHVDAHATLNDGVVVQVMGLLSNNNQALRRFMQTFVLAPE
GSVANKFYVHNDIFRYQDEVF

Sequence of entity 2 (C, D), FASTA

>9J5S_2 Polyprotein P1234 (chains C, D)
ITFGDFNDGEIESLSSELLTFGDFLP

Primary citation

Cryo-EM reveals a double oligomeric ring scaffold of the CHIKV nsP3 peptide in complex with the NTF2L domain of host G3BP1. Liu, Y., Wang, J., Han, Y. et al. mBio (2025) 16:e0396724-e0396724. DOI 10.1128/mbio.03967-24 · PubMed

Other PDB entries of the same protein (UniProt Q13283 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4FCJ 1.62 Å, Crystal structure of the NTF2-like domain of human G3BP1
3Q90 1.7 Å, Crystal structure of the NTF2 domain of Ras GTPase-activating protein-binding protein 1
8TH1 1.8 Å, Crystal Structure of the G3BP1 NTF2-like domain bound to the IDR1 of SARS-CoV-2…
5FW5 1.92 Å, Crystal structure of human G3BP1 in complex with Semliki Forest Virus nsP3-25 comprising…
6TA7 1.93 Å, Crystal structure of human G3BP1-NTF2 in complex with human CAPRIN1-derived solomon motif
8TH6 2.34 Å, Crystal Structure of the G3BP1 NTF2-like domain bound to USP10 peptide
7SUO 2.35 Å, Crystal Structure of the G3BP1 NTF2-like domain bound to the IDR1 of SARS-CoV-2…
7S17 2.36 Å, Crystal structure of human G3BP1-NTF2 with three mutations- F15W, F33W, and F124W
9CC6 2.4 Å, De novo design of high-affinity protein binders to RNA binding domain of G3bp1
7XHG 2.46 Å, Crystal structure of the NTF2L domain of human G3BP1 in complex with the Caprin-1…
8TH5 2.62 Å, Crystal Structure of the G3BP1 NTF2-like domain bound to the IDR1 of SARS-CoV-2…
9IVQ 2.66 Å, Cryo-EM structure of the CHIKV nsP3 peptide in complex with the NTF2L domain of G3BP1…

Browse structure collections

About this viewer

MolViewer shows 9J5S directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.