9KGK: Complex of LGR4 with NB18

Structure of the complex of LGR4 with NB18. Determined by electron microscopy at 2.63 Å resolution. Released 16 Jul 2025.

Method: Electron microscopy
Resolution: 2.63 Å
Organisms: Homo sapiens, Camelus dromedarius
Chains: 3
Atoms: 7,556
Mol. weight: 138.63 kDa
Released: 16 Jul 2025

Explore 9KGK in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

9KGK contains 24 α-helices and 55 β-strands across 3 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 20 helices, 32 β-strands

Element	Residues	Length	Sheet
β-strand	34	1	1
β-strand	40-41	2	2
β-strand	42	1	1
β-strand	61-62	2	2
β-strand	71-72	2	3
β-strand	85-87	3	2
β-strand	95-96	2	3
β-strand	109-111	3	2
β-strand	119	1	4
β-strand	133-135	3	2
β-strand	143	1	4
β-strand	157-159	3	2
α-helix	171-174	4
β-strand	181-183	3	2
β-strand	191-192	2	5
β-strand	205-207	3	2
β-strand	215-216	2	5
β-strand	229-231	3	2
α-helix	240-241	2
α-helix	243-246	4
β-strand	252-253	2	2
β-strand	262	1	6
β-strand	276-277	2	2
β-strand	286	1	6
β-strand	300-302	3	7
α-helix	312-313	2
β-strand	323-325	3	7
α-helix	336-338	3
β-strand	347-349	3	7
α-helix	358-360	3
β-strand	369-371	3	7
β-strand	379-380	2	8
β-strand	393-395	3	7
β-strand	403-404	2	8
β-strand	417-419	3	7
β-strand	438-440	3	7
α-helix	450-452	3
β-strand	461-463	3	7
α-helix	467-470	4
α-helix	471-473	3
β-strand	521-522	2	7
α-helix	539-564	26
α-helix	572-600	29
α-helix	605-614	10
α-helix	616-648	33
α-helix	659-682	24
α-helix	705-731	27
α-helix	740-768	29
α-helix	769-771	3
α-helix	779-789	11
α-helix	792-804	13
α-helix	806-819	14

Chain B: 2 helices, 12 β-strands

Element	Residues	Length	Sheet
β-strand	27-29	3	12
β-strand	34-35	2	13
β-strand	40-45	6	12
β-strand	56-61	6	14
β-strand	67-73	7	14
β-strand	79-81	3	14
β-strand	89-94	6	12
β-strand	99-104	6	12
α-helix	109-111	3
β-strand	113-119	7	14
α-helix	131-133	3
β-strand	136-137	2	14
β-strand	141-143	3	14
β-strand	145-146	2	13

Chain E: 2 helices, 11 β-strands

Element	Residues	Length	Sheet
β-strand	23-25	3	9
β-strand	443-449	7	9
α-helix	455-456	2
β-strand	459-464	6	10
β-strand	470-476	7	10
β-strand	482-484	3	10
β-strand	493-497	5	9
β-strand	502-507	6	9
α-helix	512-514	3
β-strand	517-521	5	10
β-strand	522	1	11
β-strand	539	1	11
β-strand	544-545	2	10

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Leucine-rich repeat-containing G-protein coupled receptor 4	A	protein	950	Homo sapiens	Q9BXB1 (AlphaFold model)
MB52	E	protein	148	Camelus dromedarius
NB18	B	protein	166	Camelus dromedarius

Sequence of entity 1 (A), FASTA

>9KGK_1 Leucine-rich repeat-containing G-protein coupled receptor 4 (chains A)
MPGPLGLLCFLALGLLGSAGPSGAAPPLCAAPCSCDGDRRVDCSGKGLTAVPEGLSAFTQ
ALDISMNNITQLPEDAFKNFPFLEELQLAGNDLSFIHPKALSGLKELKVLTLQNNQLKTV
PSEAIRGLSALQSLRLDANHITSVPEDSFEGLVQLRHLWLDDNSLTEVPVHPLSNLPTLQ
ALTLALNKISSIPDFAFTNLSSLVVLHLHNNKIRSLSQHCFDGLDNLETLDLNYNNLGEF
PQAIKALPSLKELGFHSNSISVIPDGAFDGNPLLRTIHLYDNPLSFVGNSAFHNLSDLHS
LVIRGASMVQQFPNLTGTVHLESLTLTGTKISSIPNNLCQEQKMLRTLDLSYNNIRDLPS
FNGCHALEEISLQRNQIYQIKEGTFQGLISLRILDLSRNLIHEIHSRAFATLGPITNLDV
SFNELTSFPTEGLNGLNQLKLVGNFKLKEALAAKDFVNLRSLSVPYAYQCCAFWGCDSYA
NLNTEDNSLQDHSVAQEKGTADAANVTSTLENEEHSQIIIHCTPSTGAFKPCEYLLGSWM
IRLTVWFIFLVALFFNLLVILTTFASCTSLPSSKLFIGLISVSNLFMGIYTGILTFLDAV
SWGRFAEFGIWWETGSGCKVAGFLAVFSSESAIFLLMLATVERSLSAKDIMKNGKSNHLK
QFRVAALLAFLGATVAGCFPLFHRGEYSASPLCLPFPTGETPSLGFTVTLVLLNSLAFLL
MAVIYTKLYCNLEKEDLSENSQSSMIKHVAWLIFTNCIFFCPVAFFSFAPLITAISISPE
IMKSVTLIFFPLPACLNPVLYVFFNPKFKEDWKLLKRRVTKKSGSVSVSISSQGGCLEQD
FYYDCGMYSHLQGNLTVCDCCESFLLTKPVSCKHLIKSHSCPALAVASCQRPEGYWSDCG
TQSAHSDYADEEDSFVSDSSDQVQACGRACFYQSRGFPLVRYAYNLPRVK

Sequence of entity 2 (E), FASTA

>9KGK_2 MB52 (chains E)
QVQLVESGGGLVNSKGEKLEAHVTTSKYGSLRLSCAASGYTYSPYCMGWFRQAPGKAREG
VATVDLDGSTIYADSVKGRFTISQDNAKNTLYLQMNSLKPEDTAMYYCASRTRAGVTCGL
NWAIFSYWGQGTQVTVSSHHHHHHEPEA

Sequence of entity 3 (B), FASTA

>9KGK_3 NB18 (chains B)
MKYLLPTAAAGLLLLAAQPAMAQVQLQESGGGSVQAGGSLRLSCAASGYTYSRTCMAWFR
QAPGKEREGIATINSDGTTTYADSVKGRFTISRDNAKNTLSLQMNSLKPEDTAMYYCAAA
SLSTRGCSRAEWEYRYWGQGTQVTVSSAAAYPYDVPDYGSHHHHHH

Primary citation

Structure of the complex of LGR4 with NB18. Hu, F.Z., Qiao, H.R. To be published.

Other PDB entries of the same protein (UniProt Q9BXB1 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4QXE 2.2 Å, Crystal structure of LGR4 fused with hagfish VLR
4QXF 2.25 Å, crystal structure of human LGR4 and Rspo1
4KT1 2.5 Å, Complex of R-spondin 1 with LGR4 extracellular domain
8XUM 2.9 Å, Structure of LGR4 with RSPO2
9UOK 3.05 Å, Structure of the complex of LGR4_ECD with Norrin
8XT9 3.1 Å, structure of LGR4
8XFS 3.2 Å, LGR4-RSPO2-ZNRF3 RING domain (1:2:2)
8XFP 3.21 Å, the pentamerA complex of LGR4-RSPO2-ZNRF3(delta RING)
8XFT 3.24 Å, LGR4-RSPO2-ZNRF3(1:1:1)
9KB8 3.25 Å, Cryo-EM structure of LGR4-RSPO2-ZNRF3 complex (1:1:2)
8WVY 3.29 Å, Cryo-EM structure of LGR4 in complex with Norrin
8WVX 3.32 Å, Cryo-EM structure of LGR4 in complex with Norrin(dimer)

Browse structure collections

About this viewer

MolViewer shows 9KGK directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.