9KH5: Y+LAT1

Structure of y+LAT1. Determined by electron microscopy at 3.74 Å resolution. Released 2 Apr 2025.

Method: Electron microscopy
Resolution: 3.74 Å
Organism: Homo sapiens
Chains: 1
Atoms: 3,526
Mol. weight: 57.96 kDa
Released: 2 Apr 2025

Explore 9KH5 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

9KH5 contains 20 α-helices and 2 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 20 helices, 2 β-strands

Element	Residues	Length	Sheet
α-helix	39-47	9
α-helix	54-56	3
α-helix	58-66	9
α-helix	69-96	28
α-helix	105-111	7
α-helix	114-122	9
α-helix	123-127	5
α-helix	128-144	17
α-helix	155-173	19
α-helix	178-208	31
α-helix	227-239	13
α-helix	258-284	27
α-helix	287-292	6
α-helix	296-304	9
α-helix	312-339	28
β-strand	351-352	2	1
α-helix	359-373	15
α-helix	378-405	28
α-helix	419-433	15
α-helix	440-460	21
α-helix	467-487	21
β-strand	489-490	2	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Y+L amino acid transporter 1	A	protein	529	Homo sapiens	Q9UM01 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>9KH5_1 Y+L amino acid transporter 1 (chains A)
DYKDDDDKSGPDEVDASGRVDSTEYEVASQPEVETSPLGDGASPGPEQVKLKKEISLLNG
VCLIVGNMIGSGIFVSPKGVLIYSASFGLSLVIWAVGGLFSVFGALCYAELGTTIKKSGA
SYAYILEAFGGFLAFIRLWTSLLIIEPTSQAIIAITFANYMVQPLFPSCFAPYAASRLLA
AACICLLTFINCAYVKWGTLVQDIFTYAKVLALIAVIVAGIVRLGQGASTHFENSFEGSS
FAVGDIALALYSALFSYSGWDTLNYVTEEIKNPERNLPLSIGISMPIVTIIYILTNVAYY
TVLDMRDILASDAVAVTFADQIFGIFNWIIPLSVALSCFGGLNASIVAASRLFFVGSREG
HLPDAICMIHVERFTPVPSLLFNGIMALIYLCVEDIFQLINYYSFSYWFFVGLSIVGQLY
LRWKEPDRPRPLKLSVFFPIVFCLCTIFLVAVPLYSDTINSLIGIAIALSGLPFYFLIIR
VPEHKRPLYLRRIVGSATRYLQVLCMSVAAEMDLEDGGEMPKQRDPKSN

Primary citation

Structural basis for the substrate recognition and transport mechanism of the human y + LAT1-4F2hc transporter complex. Dai, L., Zeng, Q., Zhang, T. et al. Sci Adv (2025) 11:eadq0558-eadq0558. DOI 10.1126/sciadv.adq0558 · PubMed

Other PDB entries of the same protein (UniProt Q9UM01 (AlphaFold model), which also has an AlphaFold model), best resolution first:

9KJU 2.7 Å, Local refinement of the y+LAT1-4F2hc bound with Arg
8YLP 2.9 Å, Overall structure of the y+LAT1-4F2hc bound with Arg
8XXI 3.04 Å, Structure of y+LAT1 bound with Leu
8XYJ 3.33 Å, Structure of y+LAT1 bound with Lys
9I1Z 3.45 Å, Membrane Protein Transporter

Browse structure collections

About this viewer

MolViewer shows 9KH5 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.