9KHB: Isoform Gamma-A of Fibrinogen gamma chain

Crystal structure of wild-type human fibrinogen gamma chain C-terminal domain (gamma-nodule). Determined by X-ray diffraction at 1.03 Å resolution. Released 12 Nov 2025.

Method: X-ray diffraction
Resolution: 1.03 Å
Organism: Homo sapiens
Chains: 1
Atoms: 2,437
Mol. weight: 31.1 kDa
Ligands: CA
Released: 12 Nov 2025

Explore 9KHB in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

9KHB contains 11 α-helices and 22 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 11 helices, 22 β-strands

Element	Residues	Length	Sheet
β-strand	150	1	1
α-helix	153-158	6
β-strand	165-169	5	1
β-strand	178-184	7	1
β-strand	190-197	8	1
α-helix	208-213	6
β-strand	215-216	2	1
β-strand	226-227	2	1
α-helix	230-238	9
α-helix	239-241	3
β-strand	244-251	8	1
β-strand	257-263	7	1
β-strand	266-267	2	2
α-helix	270-272	3
β-strand	276-277	2	2
β-strand	280-283	4	1
α-helix	289-291	3
α-helix	301-305	5
α-helix	310-312	3
β-strand	313	1	3
β-strand	314	1	4
β-strand	317	1	4
α-helix	326-330	5
β-strand	334	1	3
β-strand	342-343	2	5
β-strand	347	1	6
β-strand	353	1	7
α-helix	356-358	3
β-strand	366	1	6
β-strand	368-369	2	5
β-strand	377	1	7
β-strand	381-388	8	1
α-helix	389-392	4

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Isoform Gamma-A of Fibrinogen gamma chain	A	protein	273	Homo sapiens	P02679 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>9KHB_1 Isoform Gamma-A of Fibrinogen gamma chain (chains A)
YVEFVQIHDITGKDCQDIANKGAKQSGLYFIKPLKANQQFLVYCEIDGSGNGWTVFQKRL
DGSVDFKKNWIQYKEGFGHLSPTGTTEFWLGNEKIHLISTQSAIPYALRVELEDWNGRTS
TADYAMFKVGPEADKYRLTYAYFAGGDAGDAFDGFDFGDDPSDKFFTSHNGMQFSTWDND
NDKFEGNCAEQDGSGWWMNKCHAGHLNGVYYQGGTYSKASTPNGYDNGIIWATWKTRWYS
MKKTTMKIIPFNRLTIGEGQQHHLGGAKQAGDV

Ligands and cofactors

ID	Name	Formula	Copies
CA	Calcium ion	Ca	1

Water and common crystallization additives (GOL) are not listed.

Primary citation

Crystal structure of wild-type human fibrinogen gamma chain C-terminal domain (gamma-nodule). Kaido, T., Kamijo, T., Arai, S. et al. To be published.

Other PDB entries of the same protein (UniProt P02679 (AlphaFold model), which also has an AlphaFold model), best resolution first:

9KHC 1.32 Å, Crystal structure of wild-type human fibrinogen gamma chain C-terminal domain…
2Y7L 1.49 Å, Structure of N-terminal domain of Candida albicans Als9-2 in complex with human…
1DUG 1.8 Å, Structure of the fibrinogen G chain integrin binding and factor xiiia crosslinking sites…
4B60 1.83 Å, Structure of rFnBPA(189-505) in complex with fibrinogen gamma chain C- terminal peptide
2VR3 1.95 Å, Structural and Biochemical Characterization of Fibrinogen binding to ClfA from…
2FIB 2.01 Å, Recombinant human gamma-fibrinogen carboxyl terminal fragment (residues 143-411)…
1FIB 2.1 Å, Recombinant human gamma-fibrinogen carboxyl terminal fragment (residues 143-411) bound…
1FID 2.1 Å, Structure of human gamma fibrinogen 30 kd carboxyl terminal fragment
3FIB 2.1 Å, Recombinant human gamma-fibrinogen carboxyl terminal fragment (residues 143-411) bound…
1FZC 2.3 Å, Crystal structure of fragment double-D from human fibrin with two different bound ligands
3E1I 2.3 Å, Crystal Structure of BbetaD432A Variant Fibrinogen Fragment D with the Peptide Ligand…
2HWL 2.4 Å, Crystal structure of thrombin in complex with fibrinogen gamma' peptide

Browse structure collections

About this viewer

MolViewer shows 9KHB directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.