9KOX: Human Hsp90-FKBP51-PINK1 complex

human Hsp90-FKBP51-PINK1 complex. Determined by electron microscopy at 4.43 Å resolution. Released 15 Oct 2025.

Method: Electron microscopy
Resolution: 4.43 Å
Organism: Homo sapiens
Chains: 4
Atoms: 16,257
Mol. weight: 275.79 kDa
Ligands: ADP
Released: 15 Oct 2025

Explore 9KOX in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

9KOX contains 88 α-helices and 79 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 30 helices, 31 β-strands

Element	Residues	Length	Sheet
β-strand	20-21	2	13
β-strand	24	1	10
α-helix	27-37	11
α-helix	41-43	3
α-helix	47-65	19
α-helix	67-73	7
β-strand	78-80	3	18
α-helix	84-86	3
β-strand	88-93	6	18
α-helix	100-107	8
β-strand	110	1	8
α-helix	114-121	8
α-helix	138-143	6
β-strand	145	1	19
β-strand	149	1	18
β-strand	150-152	3	20
β-strand	160-163	4	20
β-strand	169-170	2	7
β-strand	171-173	3	20
β-strand	184-189	6	18
β-strand	190	1	19
α-helix	200-209	10
β-strand	218	1	18
β-strand	219-222	4	21
β-strand	286-289	4	21
α-helix	300	1
α-helix	304-305	2
α-helix	308-316	9
β-strand	323-330	8	22
β-strand	338-344	7	22
β-strand	362-363	2	22
α-helix	365-367	3
α-helix	375-377	3
β-strand	386-390	5	22
α-helix	407-429	23
α-helix	432-452	21
α-helix	456-459	4
β-strand	464-465	2	23
β-strand	467	1	24
α-helix	474	1
β-strand	475-476	2	23
α-helix	477-483	7
α-helix	485-487	3
β-strand	490-495	6	24
α-helix	499-503	5
α-helix	506-513	8
β-strand	519-521	3	24
α-helix	526-532	7
β-strand	536	1	25
β-strand	539	1	25
β-strand	540-543	4	24
α-helix	555-576	22
β-strand	587	1	26
β-strand	597-601	5	26
α-helix	608-616	9
α-helix	623-626	4
β-strand	632-636	5	26
α-helix	641-650	10
α-helix	657-672	16
α-helix	676-678	3
α-helix	681-695	15

Chain B: 26 helices, 28 β-strands

Element	Residues	Length	Sheet
β-strand	20-21	2	7
β-strand	24	1	8
α-helix	27-36	10
α-helix	41-43	3
α-helix	44-65	22
α-helix	68-73	6
β-strand	78-81	4	9
α-helix	84-86	3
β-strand	88-93	6	9
α-helix	100-107	8
β-strand	110	1	10
α-helix	114-121	8
α-helix	138-141	4
β-strand	145	1	11
β-strand	149	1	9
β-strand	150-152	3	12
β-strand	160-163	4	12
β-strand	169-170	2	13
β-strand	171-172	2	12
β-strand	184-189	6	9
β-strand	190	1	11
α-helix	200-209	10
β-strand	218-220	3	9
β-strand	288-289	2	9
α-helix	294-295	2
α-helix	306-317	12
β-strand	323-330	8	14
β-strand	338-344	7	14
β-strand	362-365	4	14
β-strand	368-369	2	14
β-strand	387-390	4	14
α-helix	407-429	23
α-helix	432-452	21
α-helix	456-460	5
β-strand	464	1	15
β-strand	467	1	16
β-strand	476	1	15
α-helix	477-480	4
β-strand	490-495	6	16
α-helix	499-503	5
α-helix	506-514	9
β-strand	519-521	3	16
α-helix	526-532	7
α-helix	536-538	3
β-strand	540-543	4	16
α-helix	555-576	22
β-strand	597-599	3	17
α-helix	608-616	9
α-helix	623-626	4
β-strand	634-636	3	17
α-helix	641-647	7
α-helix	657-672	16
α-helix	676-678	3
α-helix	681-695	15

Chain C: 19 helices, 5 β-strands

Element	Residues	Length	Sheet
β-strand	170-171	2	27
β-strand	218-219	2	27
α-helix	230-240	11
α-helix	259-261	3
α-helix	306-308	3
α-helix	313-315	3
β-strand	323-324	2	28
α-helix	325-331	7
α-helix	336-355	20
β-strand	369-370	2	28
β-strand	380	1	28
α-helix	434-447	14
α-helix	450-451	2
α-helix	452-455	4
α-helix	467-469	3
α-helix	480-488	9
α-helix	498-499	2
α-helix	500-511	12
α-helix	530-537	8
α-helix	539-541	3
α-helix	550-553	4
α-helix	556-559	4
α-helix	564-566	3
α-helix	568-579	12

Chain D: 13 helices, 15 β-strands

Element	Residues	Length	Sheet
α-helix	14-19	6
β-strand	24-25	2	1
β-strand	33-34	2	1
β-strand	36	1	2
β-strand	50	1	3
β-strand	56	1	4
α-helix	88-94	7
β-strand	102	1	4
β-strand	104	1	2
β-strand	133	1	4
β-strand	139	1	3
β-strand	150-152	3	5
β-strand	168-172	5	5
β-strand	176	1	6
β-strand	179	1	6
α-helix	193-196	4
α-helix	202-205	4
α-helix	206-208	3
β-strand	215-219	5	5
β-strand	241-250	10	5
α-helix	261-281	21
α-helix	287-298	12
α-helix	309-329	21
α-helix	334-346	13
α-helix	353-363	11
α-helix	367-380	14
α-helix	386-408	23
α-helix	412-419	8

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Peptidyl-prolyl cis-trans isomerase FKBP5	D	protein	457	Homo sapiens	Q13451 (AlphaFold model)
Heat shock protein HSP 90-alpha	A, B	protein	732	Homo sapiens	P07900 (AlphaFold model)
Serine/threonine-protein kinase PINK1, mitochondrial	C	protein	494	Homo sapiens	Q9BXM7 (AlphaFold model)

Sequence of entity 1 (D), FASTA

>9KOX_1 Peptidyl-prolyl cis-trans isomerase FKBP5 (chains D)
MTTDEGAKNNEESPTATVAEQGEDITSKKDRGVLKIVKRVGNGEETPMIGDKVYVHYKGK
LSNGKKFDSSHDRNEPFVFSLGKGQVIKAWDIGVATMKKGEICHLLCKPEYAYGSAGSLP
KIPSNATLFFEIELLDFKGEDLFEDGGIIRRTKRKGEGYSNPNEGATVEIHLEGRCGGRM
FDCRDVAFTVGEGEDHDIPIGIDKALEKMQREEQCILYLGPRYGFGEAGKPKFGIEPNAE
LIYEVTLKSFEKAKESWEMDTKEKLEQAAIVKEKGTVYFKGGKYMQAVIQYGKIVSWLEM
EYGLSEKESKASESFLLAAFLNLAMCYLKLREYTKAVECCDKALGLDSANEKGLYRRGEA
QLLMNEFESAKGDFEKVLEVNPQNKAARLQISMCQKKAKEHNERDRRIYANMFKKFAEQD
AKEEANKAMGKKTSEGVTNEKGTDSQAMEEEKPEGHV

Sequence of entity 2 (A, B), FASTA

>9KOX_2 Heat shock protein HSP 90-alpha (chains A, B)
MPEETQTQDQPMEEEEVETFAFQAEIAQLMSLIINTFYSNKEIFLRELISNSSDALDKIR
YESLTDPSKLDSGKELHINLIPNKQDRTLTIVDTGIGMTKADLINNLGTIAKSGTKAFME
ALQAGADISMIGQFGVGFYSAYLVAEKVTVITKHNDDEQYAWESSAGGSFTVRTDTGEPM
GRGTKVILHLKEDQTEYLEERRIKEIVKKHSQFIGYPITLFVEKERDKEVSDDEAEEKED
KEEEKEKEEKESEDKPEIEDVGSDEEEEKKDGDKKKKKKIKEKYIDQEELNKTKPIWTRN
PDDITNEEYGEFYKSLTNDWEDHLAVKHFSVEGQLEFRALLFVPRRAPFDLFENRKKKNN
IKLYVRRVFIMDNCEELIPEYLNFIRGVVDSEDLPLNISREMLQQSKILKVIRKNLVKKC
LELFTELAEDKENYKKFYEQFSKNIKLGIHEDSQNRKKLSELLRYYTSASGDEMVSLKDY
CTRMKENQKHIYYITGETKDQVANSAFVERLRKHGLEVIYMIEPIDEYCVQQLKEFEGKT
LVSVTKEGLELPEDEEEKKKQEEKKTKFENLCKIMKDILEKKVEKVVVSNRLVTSPCCIV
TSTYGWTANMERIMKAQALRDNSTMGYMAAKKHLEINPDHSIIETLRQKAEADKNDKSVK
DLVILLYETALLSSGFSLEDPQTHANRIYRMIKLGLGIDEDDPTADDTSAAVTEEMPPLE
GDDDTSRMEEVD

Sequence of entity 3 (C), FASTA

>9KOX_3 Serine/threonine-protein kinase PINK1, mitochondrial (chains C)
LIEEKQAESRRAVSACQEIQAIFTQKSKPGPDPLDTRRLQGFRLEEYLIGQSIGKGCSAA
VYEATMPTLPQNLEVTKSTGLLPGRGPGTSAPGEGQERAPGAPAFPLAIKMMWNISAGSS
SEAILNTMSQELVPASRVALAGEYGAVTYRKSKRGPKQLAPHPNIIRVLRAFTSSVPLLP
GALVDYPDVLPSRLHPEGLGHGRTLFLVMKNYPCTLRQYLCVNTPSPRLAAMMLLQLLEG
VDHLVQQGIAHRDLKSDNILVELDPDGCPWLVIADFGCCLADESIGLQLPFSSWYVDRGG
NGCLMAPEVSTARPGPRAVIDYSKADAWAVGAIAYEIFGLVNPFYGQGKAHLESRSYQEA
QLPALPESVPPDVRQLVRALLQREASKRPSARVAANVLHLSLWGEHILALKNLKLDKMVG
WLLQQSAATLLANRLTEKCCVETKMKMLFLANLECETLCQAALLLCSWRAALDYKDHDGG
YKDHDIDYKDDDDK

Ligands and cofactors

ID	Name	Formula	Copies
ADP	Adenosine-5'-diphosphate	C10 H15 N5 O10 P2	2

Primary citation

human Hsp90-FKBP51-PINK1 complex. Tian, X.Y., Tian, X.Y. To be published.

Other PDB entries of the same protein (UniProt Q13451 (AlphaFold model), which also has an AlphaFold model), best resolution first:

7AOT 0.85 Å, The Fk1 domain of FKBP51 in complex with (2R,5S,12R)-12-cyclohexyl-2-[2-(3,4-dimethoxyphe…
7APW 0.89 Å, The Fk1 domain of FKBP51 in complex with (1S,5S,6R)-10-(benzo[d]thiazol-6-ylsulfonyl)-5-(…
8R5K 0.89 Å, The Fk1 domain of FKBP51 in complex with Antascomicine B
7APS 0.94 Å, The Fk1 domain of FKBP51 in complex with (2S)-2-((1S,5R,6R)-10-((3,5-dichlorophenyl)sulfo…
3O5Q 0.96 Å, Fk1 domain mutant A19T of FKBP51, crystal form IV, in presence of DMSO
6TX6 0.98 Å, Crystal structure of human FKBP51 FK1 domain A19T mutant in complex with nicotinamide
8CHN 0.99 Å, The FK1 domain of FKBP51 in complex with (1S,5S,6R)-10-((S)-(3,5-dichlorophenyl)sulfonimi…
3O5P 1.0 Å, Fk1 domain mutant A19T of FKBP51, crystal form IV
4DRQ 1.0 Å, Exploration of Pipecolate Sulfonamides as Binders of the FK506-Binding Proteins 51 and…
5OBK 1.0 Å, The Fk1 domain of FKBP51 in complex with (1S,5S,6R)-10-((3,5-dichlorophenyl)sulfonyl)-5-(…
8CHP 1.0 Å, The FK1 domain of FKBP51 in complex with (1S,5S,6R)-10-((S)-(3,5-dichlorophenyl)sulfinyl)…
8CHQ 1.01 Å, The FK1 domain of FKBP51 in complex with (1S,5S,6R)-10-((S)-3,5-dichloro-N-methylphenylsu…

Browse structure collections

About this viewer

MolViewer shows 9KOX directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.