9KVS: SB290157

Structure of SB290157 bound to human C3aR in complex with Go (Receptor Ligand Focused map). Determined by electron microscopy at 2.81 Å resolution. Released 10 Jun 2026.

Method: Electron microscopy
Resolution: 2.81 Å
Organism: Homo sapiens
Chains: 1
Atoms: 2,161
Mol. weight: 60.22 kDa
Ligands: A1L6Y
Released: 10 Jun 2026

Explore 9KVS in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

9KVS contains 13 α-helices and 2 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain C: 13 helices, 2 β-strands

Element	Residues	Length	Sheet
α-helix	21-50	30
α-helix	56-83	28
α-helix	92-125	34
α-helix	127-133	7
α-helix	136-160	25
β-strand	161-164	4	1
β-strand	171-174	4	1
α-helix	332-341	10
α-helix	342-346	5
α-helix	347-362	16
α-helix	366-369	4
α-helix	372-402	31
α-helix	410-431	22
α-helix	432-436	5
α-helix	440-449	10

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Muscarinic acetylcholine receptor M4,C3a anaphylatoxin chemotactic receptor	C	protein	538	Homo sapiens	P08173 (AlphaFold model), Q16581 (AlphaFold model)

Sequence of entity 1 (C), FASTA

>9KVS_1 Muscarinic acetylcholine receptor M4,C3a anaphylatoxin chemotactic receptor (chains C)
MGKTIIALSYIFCLVFADYKDDDDAANFTPVNGSSGNQSVRLVTSSSLEVLFQGPGSASF
SAETNSTDLLSQPWNEPPVILSMVILSLTFLLGLPGNGLVLWVAGLKMQRTVNTIWFLHL
TLADLLCCLSLPFSLAHLALQGQWPYGRFLCKLIPSIIVLNMFASVFLLTAISLDRCLVV
FKPIWCQNHRNVGMACSICGCIWVVAFVMCIPVFVYREIFTTDNHNRCGYKFGLSSSLDY
PDFYGDPLENRSLENIVQPPGEMNDRLDPSSFQTNDHPWTVPTVFQPQTFQRPSADSLPR
GSARLTSQNLYSNVFKPADVVSPKIPSGFPIEDHETSPLDNSDAFLSTHLKLFPSASSNS
FYESELPQGFQDYYNLGQFTDDDQVPTPLVAITITRLVVGFLLPSVIMIACYSFIVFRMQ
RGRFAKSQSKTFRVAVVVVAVFLVCWTPYHIFGVLSLLTDPETPLGKTLMSWDHVCIALA
SANSCFNPFLYALLGKDFRKKARQSIQGILEAAFSEELTRSTHCPSNNVISERNSTTV

Ligands and cofactors

ID	Name	Formula	Copies
A1L6Y	(2S)-5-[bis(azanyl)methylideneamino]-2-[2-(2,2-diphenylethoxy)ethanoylamino]pen…	C22 H28 N4 O4	1

Primary citation

Structure of SB290157 bound to human C3aR in complex with Go (Receptor Ligand Focused map). Banerjee, R., Sano, F.K., Yadav, M.K. et al. To be published.

Other PDB entries of the same protein (UniProt P08173 (AlphaFold model), which also has an AlphaFold model), best resolution first:

7TRP 2.4 Å, Human M4 muscarinic acetylcholine receptor complex with Gi1 and the agonist iperoxo and…
8FX5 2.45 Å, Human M4 muscarinic acetylcholine receptor complex with Gi1 and xanomeline
7TRQ 2.5 Å, Human M4 muscarinic acetylcholine receptor complex with Gi1 and the agonist iperoxo and…
9N09 2.57 Å, Human M4 muscarinic acetylcholine receptor Gi1 complex (mini-Gsi chimera) bound to the…
5DSG 2.6 Å, Structure of the M4 muscarinic acetylcholine receptor (M4-mT4L) bound to tiotropium
9N29 2.6 Å, hM4Di(GRANPA) in complex with mGsI and diphenhydramine
8E9X 2.7 Å, CryoEM structure of miniGo-coupled hM4Di in complex with DCZ
9KVP 2.79 Å, Structure of SB290157 bound to human C3aR in complex with Go (Full map)
7TRK 2.8 Å, Human M4 muscarinic acetylcholine receptor complex with Gi1 and the agonist iperoxo
7TRS 2.8 Å, Human M4 muscarinic acetylcholine receptor complex with Gi1 and the endogenous agonist…
9KV6 2.88 Å, Structure of mouse TLQP21 bound to mouse C3aR in complex with Go
6KP6 3.0 Å, The structural study of mutation induced inactivation of Human muscarinic receptor M4

Browse structure collections

About this viewer

MolViewer shows 9KVS directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.