Crystal structure of the PIN1 and fragment 34 complex. Determined by X-ray diffraction at 1.53 Å resolution. Released 8 Oct 2025.
Explore 9KX7 in 3D Show helices and sheets RCSB PDB PDBe
9KX7 contains 7 α-helices and 8 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 7-8 | 2 | |
| β-strand | 11-15 | 5 | 1 |
| β-strand | 22-26 | 5 | 1 |
| β-strand | 32-33 | 2 | 1 |
| α-helix | 36-38 | 3 | |
| β-strand | 54-62 | 9 | 2 |
| α-helix | 82-98 | 17 | |
| α-helix | 103-110 | 8 | |
| α-helix | 114-118 | 5 | |
| β-strand | 121-126 | 6 | 2 |
| α-helix | 132-140 | 9 | |
| α-helix | 142 | 1 | |
| β-strand | 146 | 1 | 2 |
| β-strand | 150-152 | 3 | 2 |
| β-strand | 155-161 | 7 | 2 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Peptidyl-prolyl cis-trans isomerase NIMA-interacting 1 | A | protein | 163 | Homo sapiens | Q13526 (AlphaFold model) |
>9KX7_1 Peptidyl-prolyl cis-trans isomerase NIMA-interacting 1 (chains A) MADEEKLPPGWEKAMSRSSGRVYYFNHITNASQWERPSGNSSSGGKNGQGEPARVRCSHL LVKHSQSRRPSSWRQEKITRTKEEALELINGYIQKIKSGEEDFESLASQFSDCSSAKARG DLGAFSRGQMQKPFEDASFALRTGEMSGPVFTDSGIHIILRTE
| ID | Name | Formula | Copies |
|---|---|---|---|
| PE8 | 3,6,9,12,15,18,21-heptaoxatricosane-1,23-diol | C16 H34 O9 | 1 |
| A1EHC | imidazo[1,2-a]pyridin-6-ylmethanol | C8 H8 N2 O | 3 |
Water and common crystallization additives (SO4) are not listed.
Uncovering druggable hotspots on Pin1 via X-ray crystallographic fragment screening. Xiao, Q., Tang, J., Shu, H. et al. Eur J Med Chem (2025) 299:118048-118048. DOI 10.1016/j.ejmech.2025.118048 · PubMed
Other PDB entries of the same protein (UniProt Q13526 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 9KX7 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.