9LAF: Elongin BC-EPOP peptide

Crystal structure of Elongin BC-EPOP peptide. Determined by X-ray diffraction at 2.14 Å resolution. Released 21 May 2025.

Method: X-ray diffraction
Resolution: 2.14 Å
Organism: Homo sapiens
Chains: 3
Atoms: 1,644
Mol. weight: 25.55 kDa
Released: 21 May 2025

Explore 9LAF in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

9LAF contains 14 α-helices and 14 β-strands across 3 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 2 helices, 0 β-strands

Element	Residues	Length	Sheet
α-helix	37-39	3
α-helix	40-49	10

Chain B: 7 helices, 11 β-strands

Element	Residues	Length	Sheet
β-strand	2-9	8	1
β-strand	10	1	2
β-strand	12-19	8	1
β-strand	23	1	3
α-helix	24-35	12
α-helix	39-41	3
β-strand	42-46	5	1
β-strand	49-50	2	1
α-helix	51-52	2
β-strand	56	1	3
α-helix	57-60	4
β-strand	68	1	4
β-strand	71	1	4
α-helix	72	1
β-strand	73-79	7	1
α-helix	86-88	3
β-strand	90	1	2
α-helix	91-93	3

Chain C: 5 helices, 3 β-strands

Element	Residues	Length	Sheet
β-strand	18-22	5	1
β-strand	28-32	5	1
α-helix	33-36	4
α-helix	40-45	6
β-strand	59-61	3	1
α-helix	67-83	17
α-helix	97-99	3
α-helix	100-110	11

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Elongin-B	B	protein	104	Homo sapiens	Q15370 (AlphaFold model)
Elongin-C	C	protein	96	Homo sapiens	Q15369 (AlphaFold model)
Elongin BC and Polycomb repressive complex 2-associated protein	A	protein	26	Homo sapiens	A6NHQ4 (AlphaFold model)

Sequence of entity 1 (B), FASTA

>9LAF_1 Elongin-B (chains B)
MDVFLMIRRHKTTIFTDAKESSTVFELKRIVEGILKRPPDEQRLYKDDQLLDDGKTLGEC
GFTSQTARPQAPATVGLAFRADDTFEALCIEPFSSPPELPDVMK

Sequence of entity 2 (C), FASTA

>9LAF_2 Elongin-C (chains C)
MYVKLISSDGHEFIVKREHALTSGTIKAMLSGPGQFAENETNEVNFREIPSHVLSKVCMY
FTYKVRYTNSSTEIPEFPIAPEIALELLMAANFLDC

Sequence of entity 3 (A), FASTA

>9LAF_3 Elongin BC and Polycomb repressive complex 2-associated protein (chains A)
MHHHHHHGSEFSPLCLRALAFCALAK

Primary citation

Structural analysis of EPOP BC-box binding to the elongin BC complex. Kim, S., Yeo, H., Lee, B.I. Biochem Biophys Res Commun (2025) 759:151691-151691. DOI 10.1016/j.bbrc.2025.151691 · PubMed

Other PDB entries of the same protein (UniProt Q15370 (AlphaFold model), which also has an AlphaFold model), best resolution first:

7Z76 1.32 Å, Crystal structure of compound 10 in complex with the bromodomain of human SMARCA2 and…
9GIO 1.49 Å, Crystal structure of the VHL-EloC-EloB complex with a covalent compound bound to C77 of…
7JTO 1.7 Å, Crystal structure of Protac MS33 in complex with the WD repeat-containing protein 5 and…
8BDS 1.72 Å, Ternary complex between VCB, BRD4-BD1 and PROTAC 48
4AJY 1.73 Å, von Hippel-Lindau protein-ElonginB-ElonginC complex, bound to Hif1- alpha peptide
6GMR 1.75 Å, pVHL:EloB:EloC in complex with (4-(1H-pyrrol-1-yl)phenyl)methanol
6HR2 1.76 Å, Crystal structure of PROTAC 2 in complex with the bromodomain of human SMARCA4 and…
7ZLM 1.79 Å, Crystal structure of SOCS2:ElonginB:ElonginC in complex with compound MN551
6I7Q 1.8 Å, Structure of pVHL-elongin B-elongin C (VCB) in complex with hydroxylated-HIF-2alpha…
8BB3 1.8 Å, Structure of human WDR5 and pVHL:ElonginC:ElonginB bound to PROTAC with PEG linker…
6GFX 1.83 Å, pVHL:EloB:EloC in complex with modified HIF-1a CODD peptide containing…
1LM8 1.85 Å, Structure of a HIF-1a-pVHL-ElonginB-ElonginC Complex

Browse structure collections

About this viewer

MolViewer shows 9LAF directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.