9LFC: Human bradykinin receptor B1R

Cryo-EM structure of human bradykinin receptor B1R bound to antagonist R715. Determined by electron microscopy at 3.6 Å resolution. Released 27 May 2026.

Method: Electron microscopy
Resolution: 3.6 Å
Organisms: Homo sapiens, Lama glama, synthetic construct
Chains: 3
Atoms: 3,133
Mol. weight: 58.9 kDa
Released: 27 May 2026

Explore 9LFC in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

9LFC contains 12 α-helices and 13 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 11 helices, 2 β-strands

Element	Residues	Length	Sheet
α-helix	30-63	34
α-helix	71-88	18
α-helix	90-98	9
α-helix	106-139	34
α-helix	147-173	27
β-strand	176-181	6	1
β-strand	186-191	6	1
α-helix	196-207	12
α-helix	208-212	5
α-helix	213-230	18
α-helix	239-277	39
α-helix	284-314	31
α-helix	317-326	10

Chain C: 1 helix, 11 β-strands

Element	Residues	Length	Sheet
β-strand	4-9	6	2
β-strand	21-28	8	2
β-strand	32-39	8	3
β-strand	49-54	6	3
β-strand	59-61	3	3
β-strand	70-74	5	2
β-strand	79-83	5	2
β-strand	94-95	2	4
β-strand	96-102	7	3
α-helix	108-109	2
β-strand	110-112	3	3
β-strand	117-118	2	4

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
B1 bradykinin receptor,Kappa-type opioid receptor	A	protein	340	Homo sapiens	P41145 (AlphaFold model), P46663 (AlphaFold model)
Nanobody 6	C	protein	171	Lama glama
R715	B	protein	10	synthetic construct

Sequence of entity 1 (A), FASTA

>9LFC_1 B1 bradykinin receptor,Kappa-type opioid receptor (chains A)
ASSWPPLELQSSNQSQLFPQNATACDNAPEAWDLLHRVLPTFIISICFFGLLGNLFVLLV
FLLPRRQLNVAEIYLANLAASDLVFVLGLPFWAENIWNQFNWPFGALLCRVINGVIKANL
FIKIFLVVAICQDRYRVLVHPMASRRQQRRRQARVTCVLIWVVGGLLSIPTFLLRSIQAV
PDLNITACILLLPHEAWHFARIVELNILGFLLPLAAIVFFNYHILASLRTVRLLSGSREK
DRNLRRITRLVLVVVVAFLVCWAPYHFFAFLEFLFQVQAVRGCFWEDFIDLGLQLANFFA
FTNSSLNPVIYVFVGRLFRTKVWELYKQCTPKSLAPISSS

Sequence of entity 2 (C), FASTA

>9LFC_2 Nanobody 6 (chains C)
MLLVNQSHQGFNKEHTSKMVSAIVLYVLLAAAAHSAFAMAQVQLQESGGGLVQAGESLRL
SCAASGTIFRLYDMGWYRRVSGNQRELVASITSGGSTKYGDSVKGRFTISRDNAKNTVYL
QMSSLKPEDTAVYYCNAEYRTGIWEELLDGWGQGTQVTVSSHHHHHHEPEA

Sequence of entity 3 (B), FASTA

>9LFC_3 R715 (chains B)
XKRPPGFSXI

Primary citation

Cryo-EM structure of human bradykinin receptor B1R bound to antagonist R715. Xia, M., Zhang, H. To be published.

Other PDB entries of the same protein (UniProt P41145 (AlphaFold model), which also has an AlphaFold model), best resolution first:

7UL2 2.4 Å, CryoEM Structure of Inactive NTSR1 Bound to SR48692 and Nb6
22ES 2.43 Å, Gi bound kappa-opioid receptor in complex with difelikefalin
7T10 2.5 Å, CryoEM structure of somatostatin receptor 2 in complex with somatostatin-14 and Gi3
9PA4 2.5 Å, (S)-ketamine bound kappa-opioid receptor in complex with Gi1
8FEG 2.54 Å, CryoEM structure of Kappa Opioid Receptor bound to a semi-peptide and Gi1
9XDR 2.58 Å, Cryo-EM structure of asimadoline-BMS-986187-bound KOR-Gi1 complex
9ZZO 2.6 Å, MP1104-bound Kappa Opioid Receptor in complex with beta-arrestin1
8DZR 2.61 Å, GR89,696 bound Kappa Opioid Receptor in complex with gustducin
9PA1 2.63 Å, PCP bound kappa-opioid receptor in complex with Gi1
8DZS 2.65 Å, GR89,696 bound Kappa Opioid Receptor in complex with Gz
7T11 2.7 Å, CryoEM structure of somatostatin receptor 2 in complex with Octreotide and Gi3.
8DZP 2.71 Å, momSalB bound Kappa Opioid Receptor in complex with Gi1

Browse structure collections

About this viewer

MolViewer shows 9LFC directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.