9LFD: Human bradykinin receptor B2R

Cryo-EM structure of human bradykinin receptor B2R bound to antagonist Win64338. Determined by electron microscopy at 3.6 Å resolution. Released 27 May 2026.

Method: Electron microscopy
Resolution: 3.6 Å
Organisms: Homo sapiens, Lama glama
Chains: 2
Atoms: 2,864
Mol. weight: 57.02 kDa
Ligands: A1EJK
Released: 27 May 2026

Explore 9LFD in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

9LFD contains 14 α-helices and 10 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 14 helices, 2 β-strands

Element	Residues	Length	Sheet
α-helix	52-84	33
α-helix	91-107	17
α-helix	110-118	9
α-helix	127-160	34
α-helix	173-188	16
α-helix	191-193	3
β-strand	199-201	3	1
β-strand	208-210	3	1
α-helix	218-226	9
α-helix	227-234	8
α-helix	235-252	18
α-helix	261-284	24
α-helix	286-299	14
α-helix	306-324	19
α-helix	326-336	11
α-helix	340-352	13

Chain C: 0 helices, 8 β-strands

Element	Residues	Length	Sheet
β-strand	32-38	7	2
β-strand	51-53	3	2
β-strand	60	1	2
β-strand	72-74	3	3
β-strand	79-81	3	3
β-strand	97-102	6	2
β-strand	110-111	2	2
β-strand	114	1	2

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
B2 bradykinin receptor,Kappa-type opioid receptor	A	protein	365	Homo sapiens	P30411 (AlphaFold model), P41145 (AlphaFold model)
Nanobody 6	C	protein	133	Lama glama

Sequence of entity 1 (A), FASTA

>9LFD_1 B2 bradykinin receptor,Kappa-type opioid receptor (chains A)
LNVTLQGPTLNGTFAQSKCPQVEWLGWLNTIQPPFLWVLFVLATLENIFVLSVFCLHKSS
CTVAEIYLGNLAAADLILACGLPFWAITISNNFDWLFGETLCRVVNAIISMNLYSKIWFL
MLVSIDRYLALVKTMSMGRMRGVRWAKLYSLVIWGCTLLLSSPMLVFRTMKEYSDEGHNV
TACVISYPSLIWEVFTNMLLNVVGFLLPLSVITFCTMQIMQVLRSVRLLSGSREKDRNLR
RITRLVLVVVAVFVICWLPFQISTFLDTLHRLGILSSCQDERIIDVITQIASFMAYSNSC
LNPLVYVIVGKRFRKKSWEVYQGVCQKGGCRSEPIQMENSMGTLRTSISVERQIHKLQDW
AGSRQ

Sequence of entity 2 (C), FASTA

>9LFD_2 Nanobody 6 (chains C)
MAQVQLQESGGGLVQAGESLRLSCAASGTIFRLYDMGWYRRVSGNQRELVASITSGGSTK
YGDSVKGRFTISRDNAKNTVYLQMSSLKPEDTAVYYCNAEYRTGIWEELLDGWGQGTQVT
VSSHHHHHHEPEA

Ligands and cofactors

ID	Name	Formula	Copies
A1EJK	Win64338	C45 H68 N4 O P	1

Primary citation

Cryo-EM structure of human bradykinin receptor B2R bound to antagonist Win64338. Xia, M., Zhang, H. To be published.

Other PDB entries of the same protein (UniProt P30411 (AlphaFold model), which also has an AlphaFold model), best resolution first:

7F6I 2.8 Å, Cryo-EM structure of human bradykinin receptor BK2R in complex Gq proteins and kallidin
7F2O 2.9 Å, Cryo-EM structure of the type 2 bradykinin receptor in complex with the bradykinin and…
7F6H 2.9 Å, Cryo-EM structure of human bradykinin receptor BK2R in complex Gq proteins and bradykinin
9UVT 3.29 Å, Cryo-EM structure of bradykinin B2 receptor (B2R)-BRIL/anti BRIL SRP2070 Fab antibody…
9UVU 3.69 Å, Cryo-EM structure of bradykinin B2 receptor (B2R)-BRIL/anti BRIL SRP2070 Fab antibody…

Browse structure collections

About this viewer

MolViewer shows 9LFD directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.