9LRA: Killer immunoglobulin receptor KIR2DL2

Killer immunoglobulin receptor KIR2DL2 in complex with Pan2D Fab. Determined by X-ray diffraction at 2.6 Å resolution. Released 15 Oct 2025.

Method: X-ray diffraction
Resolution: 2.6 Å
Organism: Homo sapiens
Chains: 3
Atoms: 5,014
Mol. weight: 71.6 kDa
Ligands: NAG
Released: 15 Oct 2025

Explore 9LRA in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

9LRA contains 23 α-helices and 65 β-strands across 3 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain H: 8 helices, 21 β-strands

Element	Residues	Length	Sheet
β-strand	3-6	4	12
β-strand	10-12	3	8
β-strand	18-25	8	12
α-helix	29-31	3
β-strand	34-39	6	8
β-strand	45-52	8	8
β-strand	57-60	4	8
α-helix	62-64	3
β-strand	68-73	6	12
α-helix	74-76	3
β-strand	78-83	6	12
α-helix	88-90	3
β-strand	92-99	8	8
β-strand	108-111	4	8
β-strand	115-119	5	8
β-strand	125	1	13
α-helix	126-127	2
β-strand	128-132	5	14
β-strand	143-153	11	14
β-strand	154	1	13
β-strand	159-162	4	15
α-helix	163-165	3
β-strand	171-173	3	14
α-helix	174-176	3
β-strand	177-178	2	14
β-strand	184-193	10	14
α-helix	196-199	4
β-strand	202-208	7	15
β-strand	213-219	7	15

Chain K: 7 helices, 23 β-strands

Element	Residues	Length	Sheet
α-helix	26-28	3
β-strand	30-34	5	1
β-strand	38-40	3	2
β-strand	45-51	7	1
β-strand	57-64	8	3
β-strand	68-73	6	3
α-helix	74	1
β-strand	75-77	3	1
β-strand	80-87	8	1
α-helix	92-94	3
β-strand	96-103	8	3
β-strand	111	1	3
α-helix	113-117	5
β-strand	118-120	3	3
β-strand	121-123	3	2
β-strand	130-134	5	4
β-strand	138-140	3	5
β-strand	146-151	6	4
β-strand	157-162	6	6
β-strand	168-171	4	6
β-strand	173	1	4
α-helix	177-179	3
β-strand	181-186	6	4
β-strand	194-201	8	6
β-strand	208	1	2
β-strand	209	1	6
α-helix	211-215	5
β-strand	216-218	3	6
β-strand	219-221	3	5
α-helix	222-223	2

Chain L: 8 helices, 21 β-strands

Element	Residues	Length	Sheet
β-strand	4-7	4	7
β-strand	10-13	4	8
β-strand	19-25	7	7
α-helix	31-33	3
β-strand	34-39	6	8
β-strand	46-50	5	8
β-strand	54-55	2	8
α-helix	56	1
β-strand	63-68	6	7
β-strand	71-76	6	7
α-helix	81-83	3
β-strand	86-91	6	8
α-helix	97	1
β-strand	98-99	2	8
β-strand	103-107	5	8
β-strand	112	1	9
β-strand	115-119	5	10
α-helix	120-122	3
α-helix	123-126	4
β-strand	130-140	11	10
β-strand	141	1	9
β-strand	146-151	6	11
β-strand	155	1	11
β-strand	160-164	5	10
α-helix	165-168	4
β-strand	174-183	10	10
α-helix	184-187	4
β-strand	192-198	7	11
β-strand	206-211	6	11

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Killer cell immunoglobulin-like receptor 2DL2	K	protein	210	Homo sapiens	P43627 (AlphaFold model)
Pan2D FAB fragment light chain	L	protein	215	Homo sapiens
Pan2D FAB fragment heavy chain	H	protein	228	Homo sapiens

Sequence of entity 1 (K), FASTA

>9LRA_1 Killer cell immunoglobulin-like receptor 2DL2 (chains K)
HEGVHRKPSLLAHPGRLVKSEETVILQCWSDVRFEHFLLHREGKFKDTLHLIGEHHDGVS
KANFSIGPMMQDLAGTYRCYGSVTHSPYQLSAPSDPLDIVITGLYEKPSLSAQPGPTVLA
GESVTLSCSSRSSYDMYHLSREGEAHECRFSAGPKVNGTFQADFPLGPATHGGTYRCFGS
FRDSPYEWSNSSDPLLVSVIGNPSHHHHHH

Sequence of entity 2 (L), FASTA

>9LRA_2 Pan2D FAB FRAGMENT LIGHT CHAIN (chains L)
QIVLTQSPASMSASLGERVTMTCTASSSVSSSYLYWYQQKPGSSPKLWIYSTSNLASGVP
ARFSGSGSGTSYSLTISSMEAEDAATYYCHQYHRSPPTFGGGTKLEIKRTVAAPSVFIFP
PSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTL
TLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC

Sequence of entity 3 (H), FASTA

>9LRA_3 Pan2D FAB FRAGMENT HEAVY CHAIN (chains H)
EVQLQQSGTVLARPGASVKMSCKASGYTFTSYWMHWMKQRPGQGLEWIGTIYPGNSDTNY
NQKFKGKAKLTAVTSTNTAYMELSSLTNEDSAVYYCSRPTTATRSSAMDYWGQGTSVTVS
SASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQS
SGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTH

Ligands and cofactors

ID	Name	Formula	Copies
NAG	2-acetamido-2-deoxy-beta-D-glucopyranose	C8 H15 N O6	3

Primary citation

Selective agonists of KIR and NKG2A to evade missing self response of natural killer cells. Hiura, S., Kuwasaki, Y., Nishikawa, Y. et al. Sci Rep (2025) 15:33550-33550. DOI 10.1038/s41598-025-18394-z · PubMed

Other PDB entries of the same protein (UniProt P43627 (AlphaFold model), which also has an AlphaFold model), best resolution first:

9L4I 2.5 Å, Crystal structure of HLA-C*14:02 complexed with KIR2DL2
9LRF 2.5 Å, Killer immunoglobulin receptor KIR2DL2 in complex with KIR2DL2_KIR2DL2/3 agonist 61-Fab
2DLI 2.9 Å, Killer immunoglobulin receptor 2DL2,TRIGONAL form
8TMU 2.9 Å, HLA-B*73:01 bound to a 10mer peptide in complex with KIR2DL2
1EFX 3.0 Å, Structure of a complex between the human natural killer cell receptor KIR2DL2 and a…
2DL2 3.0 Å, Killer immunoglobulin receptor 2DL2
6PA1 3.01 Å, Killer cell immunoglobulin-like receptor 2DL2 in complex with HLA-C*07:02
9L4H 3.1 Å, Crystal structure of HLA-C*14:03 complexed with KIR2DL2
9LRH 3.4 Å, Killer immunoglobulin receptor KIR2DL2 in complex with KIR2DL2_KIR2DL2/3 agonist 61-scFv

Browse structure collections

About this viewer

MolViewer shows 9LRA directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.