9LTZ: DET1 homolog

Name: PDB 9LTZ: protein structure of DDB1-DDA1-DET1-Ube2e2 complex
Published: 2026-01-28
License: https://creativecommons.org/publicdomain/zero/1.0/
Keywords: ligase

protein structure of DDB1-DDA1-DET1-Ube2e2 complex. Determined by electron microscopy at 3.26 Å resolution. Released 28 Jan 2026.

Method: Electron microscopy
Resolution: 3.26 Å
Organism: Homo sapiens
Chains: 4
Atoms: 7,962
Mol. weight: 225.12 kDa
Released: 28 Jan 2026

Explore 9LTZ in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

9LTZ contains 27 α-helices and 114 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 8 helices, 7 β-strands

Element	Residues	Length	Sheet
α-helix	60-69	10
α-helix	71-72	2
β-strand	75-79	5	36
β-strand	86-92	7	36
α-helix	93-94	2
β-strand	103-109	7	36
α-helix	118-119	2
β-strand	120-123	4	36
β-strand	132	1	37
β-strand	137	1	36
β-strand	138	1	37
α-helix	153-165	13
α-helix	175-183	9
α-helix	185-195	11
α-helix	196-200	5

Chain F: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	41-43	3

Chain R: 9 helices, 27 β-strands

Element	Residues	Length	Sheet
α-helix	19-25	7
α-helix	35-40	6
α-helix	41-44	4
β-strand	50	1	1
β-strand	51-52	2	2
β-strand	55	1	3
β-strand	61-65	5	4
β-strand	72-75	4	4
β-strand	81-87	7	4
β-strand	104-105	2	2
α-helix	111-124	14
β-strand	125-132	8	4
β-strand	153-160	8	5
β-strand	189-197	9	5
β-strand	206-212	7	5
α-helix	217-219	3
β-strand	222-225	4	6
β-strand	228-232	5	6
β-strand	239-244	6	6
β-strand	250-255	6	6
α-helix	267-270	4
α-helix	294-305	12
α-helix	323-326	4
β-strand	331	1	7
β-strand	338	1	7
β-strand	341-346	6	7
β-strand	364-369	6	7
β-strand	378-379	2	7
α-helix	459-461	3
β-strand	466-468	3	8
β-strand	489-491	3	8
β-strand	497	1	8
β-strand	519-521	3	3
β-strand	529-534	6	3
β-strand	539-544	6	3
β-strand	545	1	1

Chain S: 9 helices, 80 β-strands

Element	Residues	Length	Sheet
β-strand	4-6	3	9
β-strand	7-10	4	10
β-strand	17-21	5	11
β-strand	30-34	5	11
β-strand	39-41	3	11
β-strand	53-55	3	11
β-strand	63	1	12
β-strand	66-67	2	13
β-strand	76-77	2	13
β-strand	80	1	12
β-strand	86	1	12
β-strand	87-88	2	14
β-strand	89	1	13
β-strand	91-92	2	15
β-strand	99-100	2	15
β-strand	104-105	2	14
β-strand	121-124	4	16
β-strand	130-134	5	16
β-strand	143-144	2	16
β-strand	164-169	6	17
β-strand	177-184	8	17
β-strand	187-195	9	17
β-strand	202-203	2	17
α-helix	208-209	2
β-strand	210-212	3	17
β-strand	218-221	4	18
β-strand	229-232	4	18
β-strand	237-241	5	18
β-strand	244-248	5	18
β-strand	270-272	3	19
β-strand	279-289	11	19
β-strand	295-307	13	19
α-helix	310-311	2
β-strand	313-314	2	20
β-strand	324-325	2	20
β-strand	332	1	20
β-strand	362	1	21
β-strand	377	1	21
β-strand	378-379	2	22
α-helix	382-384	3
β-strand	386-387	2	22
β-strand	716	1	22
β-strand	721	1	23
β-strand	726-727	2	23
β-strand	732-741	10	23
β-strand	763-765	3	23
β-strand	786-795	10	23
β-strand	801-806	6	23
β-strand	811-817	7	24
β-strand	830-835	6	24
β-strand	845-847	3	25
β-strand	850-853	4	24
β-strand	858-862	5	24
β-strand	865-867	3	25
β-strand	870-877	8	26
β-strand	879-884	6	26
β-strand	890	1	27
β-strand	903	1	27
β-strand	913-917	5	28
β-strand	920-924	5	28
β-strand	930-936	7	28
β-strand	941-947	7	28
β-strand	954	1	29
β-strand	959	1	30
β-strand	964-965	2	30
β-strand	969	1	29
β-strand	973	1	31
β-strand	976-978	3	30
α-helix	986-989	4
β-strand	991	1	28
β-strand	993-996	4	30
β-strand	997	1	32
β-strand	999	1	31
β-strand	1007-1009	3	33
β-strand	1025-1030	6	33
β-strand	1031	1	10
β-strand	1037-1039	3	10
β-strand	1040-1042	3	33
α-helix	1045-1058	14
α-helix	1070-1072	3
β-strand	1076-1078	3	34
β-strand	1081-1083	3	34
β-strand	1086-1087	2	32
β-strand	1088-1090	3	9
α-helix	1091-1096	6
α-helix	1102-1108	7
β-strand	1114-1115	2	35
β-strand	1121-1122	2	35
α-helix	1128-1130	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
DET1 homolog	R	protein	550	Homo sapiens	Q7L5Y6 (AlphaFold model)
DNA damage-binding protein 1	S	protein	1140	Homo sapiens	Q16531 (AlphaFold model)
Ubiquitin-conjugating enzyme E2 E2	A	protein	201	Homo sapiens	Q96LR5 (AlphaFold model)
DET1- and DDB1-associated protein 1	F	protein	102	Homo sapiens	Q9BW61 (AlphaFold model)

Sequence of entity 1 (R), FASTA

>9LTZ_1 DET1 homolog (chains R)
MDHHVSTIKPRRIQNQNVIHRLERRRISSGKAGTHWHQVRVFHQNVFPNFTVVNVEKPPC
FLRKFSPDGRYFIAFSSDQTSLEIYEYQGCQAAEDLLQGYEGEILSNGNDQRSVNIRGRL
FERFFVLLHITNVAANGEHLNRECSLFTDDCRCVIVGSAAYLPDEPHPPFFEVYRNSESV
TPNPRSPLEDYSLHIIDLHTGRLCDTRTFKCDKVVLSHNQGLYLYKNILAILSVQQQTIH
VFQVTPEGTFIDVRTIGRFCYEDDLLTVSAVFPEVQRDSQTGMANPFRDPFINSLKHRLL
VYLWRRAEQDGSAMAKRRFFQYFDQLRQLRMWKMQLLDENHLFIKYTSEDVVTLRVTDPS
QASFFVVYNMVTTEVIAVFENTSDELLELFENFCDLFRNATLHSEVQFPCSASSNNFARQ
IQRRFKDTIINAKYGGHTEAVRRLLGQLPISAQSYSGSPYLDLSLFSYDDKWVSVMERPK
TCGDHPIRFYARDSGLLKFEIQAGLLGRPINHTVRRLVAFTFHPFEPFAISVQRTNAEYV
VNFHMRHCCT

Sequence of entity 2 (S), FASTA

>9LTZ_2 DNA damage-binding protein 1 (chains S)
MSYNYVVTAQKPTAVNGCVTGHFTSAEDLNLLIAKNTRLEIYVVTAEGLRPVKEVGMYGK
IAVMELFRPKGESKDLLFILTAKYNACILEYKQSGESIDIITRAHGNVQDRIGRPSETGI
IGIIDPECRMIGLRLYDGLFKVIPLDRDNKELKAFNIRLEELHVIDVKFLYGCQAPTICF
VYQDPQGRHVKTYEVSLREKEFNKGPWKQENVEAEASMVIAVPEPFGGAIIIGQESITYH
NGDKYLAIAPPIIKQSTIVCHNRVDPNGSRYLLGDMEGRLFMLLLEKEEQMDGTVTLKDL
RVELLGETSIAECLTYLDNGVVFVGSRLGDSQLVKLNVDSNEQGSYVVAMETFTNLGPIV
DMCVVDLERQGQGQLVTCSGAFKEGSLRIIRNGIGIHEHASIDLPGIKGLWPLRSDPNRE
TDDTLVLSFVGQTRVLMLNGEEVEETELMGFVDDQQTFFCGNVAHQQLIQITSASVRLVS
QEPKALVSEWKEPQAKNISVASCNSSQVVVAVGRALYYLQIHPQELRQISHTEMEHEVAC
LDITPLGDSNGLSPLCAIGLWTDISARILKLPSFELLHKEMLGGEIIPRSILMTTFESSH
YLLCALGDGALFYFGLNIETGLLSDRKKVTLGTQPTVLRTFRSLSTTNVFACSDRPTVIY
SSNHKLVFSNVNLKEVNYMCPLNSDGYPDSLALANNSTLTIGTIDEIQKLHIRTVPLYES
PRKICYQEVSQCFGVLSSRIEVQDTSGGTTALRPSASTQALSSSVSSSKLFSSSTAPHET
SFGEEVEVHNLLIIDQHTFEVLHAHQFLQNEYALSLVSCKLGKDPNTYFIVGTAMVYPEE
AEPKQGRIVVFQYSDGKLQTVAEKEVKGAVYSMVEFNGKLLASINSTVRLYEWTTEKELR
TECNHYNNIMALYLKTKGDFILVGDLMRSVLLLAYKPMEGNFEEIARDFNPNWMSAVEIL
DDDNFLGAENAFNLFVCQKDSAATTDEERQHLQEVGLFHLGEFVNVFCHGSLVMQNLGET
STPTQGSVLFGTVNGMIGLVTSLSESWYNLLLDMQNRLNKVIKSVGKIEHSFWRSFHTER
KTEPATGFIDGDLIESFLDISRPKMQEVVANLQYDDGSGMKREATADDLIKVVEELTRIH

Sequence of entity 3 (A), FASTA

>9LTZ_3 Ubiquitin-conjugating enzyme E2 E2 (chains A)
MSTEAQRVDDSPSTSGGSSDGDQRESVQQEPEREQVQPKKKEGKISSKTAAKLSTSAKRI
QKELAEITLDPPPNCGAGPKGDNIYEWRSTILGPPGSVYEGGVFFLDITFSPDYPFKPPK
VTFRTRIYHCNINSQGVISLDILKDNWSPALTISKVLLSICSLLTDCNPADPLVGSIATQ
YMTNRAEHDRMARQWTKRYAT

Sequence of entity 4 (F), FASTA

>9LTZ_4 DET1- and DDB1-associated protein 1 (chains F)
MADFLKGLPVYNKSNFSRFHADSVCKASNRRPSVYLPTREYPSEQIIVTEKTNILLRYLH
QQWDKKNAAKKRDQEQVELEGESSAPPRKVARTDSPDMHEDT

Primary citation

Cryo-EM structure of the human COP1-DET1 ubiquitin ligase complex. Wang, S., Teng, F., Stjepanovic, G. et al. Nat Commun (2026) 17:543-543. DOI 10.1038/s41467-026-68375-7 · PubMed

Other PDB entries of the same protein (UniProt Q7L5Y6 (AlphaFold model), which also has an AlphaFold model), best resolution first:

9LTJ 2.65 Å, Cryo-EM structure of DDB1-DDA1-DET1 complex
9BJZ 2.83 Å, Structure of the human DDD-Ube2e2 complex
9DHD 2.9 Å, The ternary complex of DDB1, DDA1, DET1
9LTO 2.92 Å, Cryo-EM structure of DDB1-DDA1-DET1-Ube2e2 complex
9LTL 2.93 Å, Cryo-EM structure of DDB1-DDA1-DET1 complex
9LTR 3.03 Å, Cryo-EM structure of dimeric DDB1-DDA1-DET1-Ube2e2-COP1 complex
9LTW 3.25 Å, protein structure of DDB1-DDA1-DET1
9LU1 3.62 Å, protein structure of DDB1-DDA1-DET1-Ube2e2 bound to COP1 dimer
9W90 3.7 Å, DDB1-DDA1-DET1-Ube2e2-COP1-c-Jun-STK40 complex
9M0Y 4.25 Å, Local refinement of stacked like DDB1-DDA1-DET1-Ube2e2-COP1 complex (layer 2)
9LUL 4.99 Å, Local refinement of stacked like DDB1-DDA1-DET1-Ube2e2-COP1 complex (layer 1)

Browse structure collections

About this viewer

MolViewer shows 9LTZ directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.