9LZX: OTU domain of OTULIN

Crystal structure of the OTU domain of OTULIN in complex with 11B6. Determined by X-ray diffraction at 2.0 Å resolution. Released 4 Mar 2026.

Method: X-ray diffraction
Resolution: 2.0 Å
Organism: Homo sapiens
Chains: 1
Atoms: 2,346
Mol. weight: 33.82 kDa
Ligands: A1EMF
Released: 4 Mar 2026

Explore 9LZX in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

9LZX contains 19 α-helices and 10 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 19 helices, 10 β-strands

Element	Residues	Length	Sheet
β-strand	82	1	1
α-helix	83-85	3
β-strand	86-87	2	2
α-helix	88-95	8
α-helix	101-113	13
β-strand	119-122	4	2
β-strand	123	1	1
α-helix	124	1
α-helix	129-140	12
α-helix	147-150	4
α-helix	153-164	12
α-helix	166-170	5
α-helix	184-203	20
α-helix	208-218	11
α-helix	223-248	26
α-helix	255-262	8
α-helix	269-272	4
α-helix	273-277	5
β-strand	280	1	3
β-strand	284	1	3
α-helix	285-287	3
α-helix	288-298	11
β-strand	301-306	6	2
α-helix	307-309	3
α-helix	313-315	3
β-strand	316-318	3	2
α-helix	328	1
β-strand	329-336	8	2
β-strand	339-344	6	2

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Ubiquitin thioesterase otulin	A	protein	288	Homo sapiens	Q96BN8 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>9LZX_1 Ubiquitin thioesterase otulin (chains A)
HHHHHHSSGENLYFQGAMDPHMLSVAPEMDIMDYCKKEWRGNTQKATCMKMGYEEVSQKF
TSIRRVRGDNYCALRATLFQAMSQAVGLPPWLQDPELMLLPEKLISKYNWIKQWKLGLKF
DGKNEDLVDKIKESLTLLRKKWAGLAEMRTAEARQIACDELFTNEAEEYSLYEAVKFLML
NRAIELYNDKEKGKEVPFFSVLLFARDTSNDPGQLLRNHLNQVGHTGGLEQVEMFLLAYA
VRHTIQVYRLSKYNTEEFITVYPTDPPKDWPVVTLIAEDDRHYNIPVR

Ligands and cofactors

ID	Name	Formula	Copies
A1EMF	3-phenyl-5-prop-2-enylsulfanyl-4~{H}-1,2,4-triazole	C11 H11 N3 S	1

Primary citation

A novel bioluminescent screening system for detecting OTULIN deubiquitinase activity. Zhang, M., Huang, H. To be published.

Other PDB entries of the same protein (UniProt Q96BN8 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3ZNV 1.3 Å, Crystal structure of the OTU domain of OTULIN at 1.3 Angstroms.
3ZNX 1.35 Å, Crystal structure of the OTU domain of OTULIN D336A mutant
4KSJ 1.6 Å, Crystal structure of the OTU domain of Gumby/Fam105B at 1.6 angstrom
6I9C 1.77 Å, Structure of the OTU domain of OTULIN G281R mutant
3ZNZ 1.9 Å, Crystal structure of OTULIN OTU domain (C129A) in complex with Met1- di ubiquitin
6SAK 2.0 Å, Structure of the OTULINcat C129A - SNX27 PDZ domain complex.
4OYK 2.0 Å, Structure of HOIP PUB domain bound to OTULIN PIM
4KSK 2.4 Å, Gumby/Fam105B in complex with ubiquitin
4P0B 2.7 Å, Crystal structure of HOIP PUB domain in complex with OTULIN PIM
4KSL 2.83 Å, Gumby/Fam105B in complex with linear di-ubiquitin
5OE7 2.95 Å, Structure of OTULIN bound to the Met1-linked diubiquitin activity probe

Browse structure collections

About this viewer

MolViewer shows 9LZX directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.