9M0D: Neurotensin receptor 1

Cryo-EM structure of neurotensin receptor 1 in complex with beta-arrestin 1. Determined by electron microscopy at 3.41 Å resolution. Released 9 Apr 2025.

Method: Electron microscopy
Resolution: 3.41 Å
Organisms: Escherichia coli, Homo sapiens
Chains: 4
Atoms: 6,312
Mol. weight: 160.47 kDa
Released: 9 Apr 2025

Explore 9M0D in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

9M0D contains 26 α-helices and 83 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain B: 9 helices, 33 β-strands

Element	Residues	Length	Sheet
β-strand	8-11	4	1
β-strand	17-21	5	1
β-strand	28	1	2
β-strand	33	1	2
β-strand	36	1	3
β-strand	39-42	4	1
β-strand	52-61	10	4
β-strand	75-77	3	4
β-strand	81-84	4	4
α-helix	97-107	11
β-strand	111-113	3	1
β-strand	116	1	3
α-helix	127	1
β-strand	128	1	5
α-helix	129-131	3
β-strand	141-149	9	4
α-helix	159-161	3
β-strand	164-167	4	4
β-strand	172	1	6
β-strand	182	1	7
β-strand	185-187	3	8
α-helix	189-191	3
α-helix	195	1
β-strand	196-198	3	8
β-strand	201	1	7
β-strand	206	1	9
β-strand	213	1	10
β-strand	216-221	6	8
β-strand	227-240	14	11
β-strand	246-257	12	11
β-strand	265-270	6	8
β-strand	273	1	10
β-strand	287	1	5
β-strand	288	1	12
β-strand	299	1	12
α-helix	300-301	2
β-strand	316-328	13	11
α-helix	329-330	2
β-strand	341-348	8	11
β-strand	349	1	9
β-strand	352	1	6
α-helix	353-355	3

Chain D: 4 helices, 28 β-strands

Element	Residues	Length	Sheet
β-strand	29-30	2	13
β-strand	33-35	3	14
β-strand	40-43	4	15
β-strand	44-45	2	13
β-strand	46	1	16
β-strand	55-62	8	14
β-strand	68-74	7	14
β-strand	81-83	3	14
β-strand	91	1	15
β-strand	96	1	16
β-strand	101	1	16
β-strand	104-107	4	15
α-helix	111-113	3
β-strand	115-123	9	14
β-strand	130-133	4	14
β-strand	137-141	5	14
α-helix	144-146	3
β-strand	152-154	3	17
β-strand	165	1	18
β-strand	169-171	3	17
β-strand	175	1	19
β-strand	180-184	5	20
α-helix	185-187	3
β-strand	193-194	2	17
β-strand	199-200	2	19
α-helix	201	1
β-strand	206-207	2	19
β-strand	210-212	3	17
β-strand	215	1	18
β-strand	225-230	6	20
β-strand	236	1	20
β-strand	239-240	2	20

Chain Q: 5 helices, 22 β-strands

Element	Residues	Length	Sheet
β-strand	26-27	2	21
β-strand	31-33	3	22
β-strand	44-45	2	21
β-strand	54-59	6	22
β-strand	66-70	5	22
β-strand	74-75	2	22
α-helix	76	1
β-strand	84-85	2	23
β-strand	91	1	21
β-strand	94-95	2	23
α-helix	101-103	3
β-strand	106-111	6	22
β-strand	119	1	22
β-strand	123-126	4	22
β-strand	137-138	2	24
α-helix	140-142	3
α-helix	143-148	6
β-strand	150-151	2	25
β-strand	155-160	6	24
β-strand	171	1	26
β-strand	174	1	26
β-strand	181-184	4	24
β-strand	194-199	6	24
β-strand	202-203	2	25
α-helix	204-209	6
β-strand	213	1	27
β-strand	231	1	27

Chain R: 8 helices, 0 β-strands

Element	Residues	Length
α-helix	61-89	29
α-helix	100-128	29
α-helix	141-170	30
α-helix	184-200	17
α-helix	230-264	35
α-helix	300-326	27
α-helix	336-366	31
α-helix	369-381	13

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Soluble cytochrome b562,Neurotensin receptor type 1	R	protein	557	Escherichia coli, Homo sapiens	P30989 (AlphaFold model)
Beta-arrestin-1	B	protein	402	Homo sapiens	P49407 (AlphaFold model)
Fab30 heavy chain	D	protein	260	Homo sapiens
Fab30 light chain	Q	protein	235	Homo sapiens

Sequence of entity 1 (R), FASTA

>9M0D_1 Soluble cytochrome b562,Neurotensin receptor type 1 (chains R)
MKTIIALSYIFCLVFAGSADLEDNWETLNDNLKVIEKADNAAQVKDALTKMRAAALDAQK
ATPPKLEDKSPDSPEMKDFRHGFDILVGQIDDALKLANEGKVKEAQAAAEQLKTTRNAYI
QKYLASGSLEVLFQGPMRLNSSAPGTPGTPAADPFQRAQAGLEEALLAPGFGNASGNASE
RVLAAPSSELDVNTDIYSKVLVTAVYLALFVVGTVGNTVTAFTLARKKSLQSLQSTVHYH
LGSLALSDLLTLLLAMPVELYNFIWVHHPWAFGDAGCRGYYFLRDACTYATALNVASLSV
ERYLALCHPFKAKTLMSRSRTKKFISAIWLASALLAVPMLFTMGEQNRSADGQHAGGLVC
TPTIHTATVKVVIQVNTFMSFIFPMVVISVLNTIIANKLTVMVRQAAEQGQVCTVGGEHS
TFSMAIEPGRVQALRHGVRVLRAVVIAFVVCWLPYHVRRLMFCYISDEQWTPFLYDFYHY
FYMVTNALFYVSSTINPILYNLVSANFRHIFLATLACLCPVWRRRRKRPCFNAFSRKCDS
VSSNHTLSSNATRETLY

Sequence of entity 2 (B), FASTA

>9M0D_2 Beta-arrestin-1 (chains B)
MGSHHHHHHHHGSLEVLFQGPGDKGTRVFKKASPNGKLTVYLGKRDFVDHIDLVDPVDGV
VLVDPEYLKERRVYVTLTCAFRYGREDLDVLGLTFRKDLFVANVQSFPPAPEDKKPLTRL
QERLIKKLGEHAYPFTFEIPPNLPCSVTLQPGPEDTGKACGVDYEVKAFCAENLEEKIHK
RNSVRLVIRKVQYAPERPGPQPTAETTRQFLMSDKPLHLEASLDKEIYYHGEPISVNVHV
TNNTNKTVKKIKISVRQYADICLFNTAQYKCPVAMEEADDTVAPSSTFCKVYTLTPFLAN
NREKRGLALDGKLKHEDTNLASSTLLREGANREILGIIVSYKVKVKLVVSRGGLLGDLAS
SDVAVELPFTLMHPKPKEEPPHREVPENETPVDTNLIELDTN

Sequence of entity 3 (D), FASTA

>9M0D_3 Fab30 heavy chain (chains D)
MVSAIVLYVLLAAAAHSAFAEISEVQLVESGGGLVQPGGSLRLSCAASGFNVYSSSIHWV
RQAPGKGLEWVASISSYYGYTYYADSVKGRFTISADTSKNTAYLQMNSLRAEDTAVYYCA
RSRQFWYSGLDYWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPV
TVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKK
VEPKSCDKTAAAHHHHHHHH

Sequence of entity 4 (Q), FASTA

>9M0D_4 Fab30 light chain (chains Q)
MVSAIVLYVLLAAAAHSAFASDIQMTQSPSSLSASVGDRVTITCRASQSVSSAVAWYQQK
PGKAPKLLIYSASSLYSGVPSRFSGSRSGTDFTLTISSLNPEDFATYYCQQYKYVPVTFG
QGTKVEIKRTVAAPSVFIFPPSDSQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNS
QESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC

Primary citation

Molecular mechanism of the arrestin-biased agonism of neurotensin receptor 1 by an intracellular allosteric modulator. Sun, D., Li, X., Yuan, Q. et al. Cell Res (2025) 35:284-295. DOI 10.1038/s41422-025-01095-7 · PubMed

Other PDB entries of the same protein (UniProt P30989 (AlphaFold model), which also has an AlphaFold model), best resolution first:

9P7Z 2.1 Å, NTSR1-Gi-NTS(8-13) Complex in the Canonical, AHD Open State (C-Open-Apo)
9YCX 2.1 Å, Neurotensin Receptor 1 (NTSR1) bound to Octotensin in complex with Gi3 in the…
9YCY 2.2 Å, Neurotensin Receptor 1 (NTSR1) bound to Octotensin in complex with Gi3 in the Canonical…
9VAW 2.24 Å, Cryo-EM structure of human Neurotensin Receptor 1 (hNTSR1)-Gq (delipidated) complex in…
9P80 2.3 Å, NTSR1-Gi-NTS(8-13) Complex in the Non-Canonical, AHD Open State (NC-Open-Apo)
20ZG 2.4 Å, Cryo-EM structure of the human neurotensin receptor 1 (hNTSR1)-Gi1 complex in the…
20ZH 2.4 Å, Cryo-EM structure of the human neurotensin receptor 1 (hNTSR1)-Gi1 complex in the…
7UL2 2.4 Å, CryoEM Structure of Inactive NTSR1 Bound to SR48692 and Nb6
9P82 2.4 Å, NTSR1-Gi-NTS(8-13) GTP-Bound Complex in the Canonical, AHD Closed State (C-Closed-GTP)
20ZC 2.6 Å, Cryo-EM structure of human Neurotensin Receptor 1 (hNTSR1)-Gi1 (delipidated) complex in…
9P81 2.6 Å, NTSR1-Gi-NTS(8-13), GTP-bound Complex in the Canonical, AHD Open State (C-Open-GTP)
8ZYT 2.65 Å, Cryo-EM structure of neurotensin receptor 1 in complex with beta-arrestin1 and SBI-553…

Browse structure collections

About this viewer

MolViewer shows 9M0D directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.