The crystal structure of full-length PAK2 containing K278R and D368N mutants. Determined by X-ray diffraction at 3.02 Å resolution. Released 13 Aug 2025.
Explore 9M41 in 3D Show helices and sheets RCSB PDB PDBe
9M41 contains 44 α-helices and 27 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 88-89 | 2 | 1 |
| β-strand | 95-96 | 2 | 1 |
| α-helix | 100-108 | 9 | |
| α-helix | 113-118 | 6 | |
| α-helix | 120-130 | 11 | |
| α-helix | 229-235 | 7 | |
| α-helix | 236-238 | 3 | |
| β-strand | 240-241 | 2 | 2 |
| α-helix | 245-248 | 4 | |
| β-strand | 249-256 | 8 | 2 |
| β-strand | 262-268 | 7 | 2 |
| β-strand | 274-281 | 8 | 2 |
| α-helix | 288-298 | 11 | |
| β-strand | 306 | 1 | 3 |
| α-helix | 307-308 | 2 | |
| β-strand | 309-315 | 7 | 2 |
| β-strand | 318-324 | 7 | 2 |
| β-strand | 330 | 1 | 3 |
| α-helix | 331-335 | 5 | |
| α-helix | 342-361 | 20 | |
| β-strand | 365 | 1 | 4 |
| β-strand | 374-376 | 3 | 3 |
| β-strand | 382-384 | 3 | 3 |
| β-strand | 392 | 1 | 4 |
| α-helix | 412-415 | 4 | |
| α-helix | 423-438 | 16 | |
| α-helix | 448-458 | 11 | |
| α-helix | 462-464 | 3 | |
| α-helix | 466-468 | 3 | |
| α-helix | 471-480 | 10 | |
| α-helix | 489-490 | 2 | |
| α-helix | 491-494 | 4 | |
| α-helix | 500-502 | 3 | |
| α-helix | 503-505 | 3 | |
| α-helix | 506-509 | 4 | |
| α-helix | 510-519 | 10 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 87 | 1 | 5 |
| β-strand | 96 | 1 | 5 |
| α-helix | 100-107 | 8 | |
| α-helix | 113-118 | 6 | |
| α-helix | 120-132 | 13 | |
| α-helix | 229-235 | 7 | |
| α-helix | 240-242 | 3 | |
| α-helix | 245-248 | 4 | |
| β-strand | 249-256 | 8 | 6 |
| β-strand | 262-268 | 7 | 6 |
| β-strand | 274-281 | 8 | 6 |
| α-helix | 289-298 | 10 | |
| β-strand | 306 | 1 | 7 |
| α-helix | 307-308 | 2 | |
| β-strand | 309-315 | 7 | 6 |
| β-strand | 318-324 | 7 | 6 |
| β-strand | 330 | 1 | 7 |
| α-helix | 331-335 | 5 | |
| α-helix | 342-361 | 20 | |
| β-strand | 365 | 1 | 8 |
| β-strand | 374-376 | 3 | 7 |
| β-strand | 382-384 | 3 | 7 |
| α-helix | 387-389 | 3 | |
| β-strand | 392 | 1 | 8 |
| α-helix | 412-415 | 4 | |
| α-helix | 423-438 | 16 | |
| α-helix | 448-457 | 10 | |
| α-helix | 461-463 | 3 | |
| α-helix | 466-468 | 3 | |
| α-helix | 471-480 | 10 | |
| α-helix | 491-495 | 5 | |
| α-helix | 498-502 | 5 | |
| α-helix | 503-505 | 3 | |
| α-helix | 506-509 | 4 | |
| α-helix | 510-519 | 10 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Serine/threonine-protein kinase PAK 2 | A, B | protein | 547 | Homo sapiens | Q13177 (AlphaFold model) |
>9M41_1 Serine/threonine-protein kinase PAK 2 (chains A, B) MGSSHHHHHHSSGLVPRGSHMASMSDNGELEDKPPAPPVRMSSTIFSTGGKDPLSANHSL KPLPSVPEEKKPRHKIISIFSGTEKGSKKKEKERPEISPPSDFEHTIHVGFDAVTGEFTG MPEQWARLLQTSNITKLEQKKNPQAVLDVLKFYDSNTVKQKYLSFTPPEKDGFPSGTPAL NAKGTEAPAVVTEEEDDDEETAPPVIAPRPDHTKSIYTRSVIDPVPAPVGDSHVDGAAKS LDKQKKKTKMTDEEIMEKLRTIVSIGDPKKKYTRYEKIGQGASGTVFTATDVALGQEVAI RQINLQKQPKKELIINEILVMKELKNPNIVNFLDSYLVGDELFVVMEYLAGGSLTDVVTE TCMDEAQIAAVCRECLQALEFLHANQVIHRNIKSDNVLLGMEGSVKLTDFGFCAQITPEQ SKRSTMVGTPYWMAPEVVTRKAYGPKVDIWSLGIMAIEMVEGEPPYLNENPLRALYLIAT NGTPELQNPEKLSPIFRDFLNRCLEMDVEKRGSAKELLQHPFLKLAKPLSSLTPLIMAAK EAMKSNR
| ID | Name | Formula | Copies |
|---|---|---|---|
| PO4 | Phosphate ion | O4 P | 1 |
Crystal structures of PAK2 reveal new insights into its autoinhibitory mechanism. Hu, H.F., Luo, Z., Zhang, Y. et al. Structure (2025) 33:1663. DOI 10.1016/j.str.2025.07.008 · PubMed
Other PDB entries of the same protein (UniProt Q13177 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 9M41 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.