9MAN: Norrin

Structure of Norrin in complex with human Tspan12 large extracellular loop (Tspan12 LEL). Determined by electron microscopy at 3.78 Å resolution. Released 18 Mar 2026.

Method: Electron microscopy
Resolution: 3.78 Å
Organisms: Escherichia coli O157:H7, Homo sapiens
Chains: 4
Atoms: 3,066
Mol. weight: 224 kDa
Released: 18 Mar 2026

Explore 9MAN in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

9MAN contains 19 α-helices and 28 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 1 helix, 13 β-strands

Element	Residues	Length	Sheet
β-strand	40-46	7	1
β-strand	49	1	2
β-strand	55-56	2	2
β-strand	60-66	7	1
β-strand	67	1	3
α-helix	72	1
β-strand	73-77	5	4
β-strand	80	1	5
β-strand	89-92	4	4
β-strand	94-98	5	6
β-strand	101-108	8	7
β-strand	109-110	2	2
β-strand	116-123	8	7
β-strand	126-130	5	6

Chain B: 1 helix, 11 β-strands

Element	Residues	Length	Sheet
β-strand	40-46	7	4
β-strand	56-57	2	5
β-strand	60-67	8	4
α-helix	72	1
β-strand	73	1	3
β-strand	74-77	4	8
β-strand	80	1	7
β-strand	89-92	4	8
β-strand	94-98	5	9
β-strand	101-109	9	5
β-strand	116-123	8	5
β-strand	126-130	5	9

Chain C: 10 helices, 2 β-strands

Element	Residues	Length	Sheet
α-helix	129-134	6
α-helix	135-137	3
α-helix	141-143	3
α-helix	144-156	13
α-helix	166-171	6
α-helix	177-178	2
α-helix	179-181	3
β-strand	182	1	11
α-helix	189-195	7
α-helix	198-200	3
β-strand	201	1	11
α-helix	206-214	9

Chain D: 7 helices, 2 β-strands

Element	Residues	Length	Sheet
α-helix	129-134	6
α-helix	141-143	3
α-helix	144-156	13
α-helix	166-171	6
α-helix	179-181	3
β-strand	182	1	10
α-helix	189-195	7
β-strand	201	1	10
α-helix	207-214	8

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Maltose/maltodextrin-binding periplasmic protein,Norrin	A, B	protein	500	Escherichia coli O157:H7, Homo sapiens	P0AEY0 (AlphaFold model), Q00604 (AlphaFold model)
Maltose/maltodextrin-binding periplasmic protein,Tetraspanin-12	C, D	protein	501	Escherichia coli O157:H7, Homo sapiens	O95859 (AlphaFold model), P0AEY0 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>9MAN_1 Maltose/maltodextrin-binding periplasmic protein,Norrin (chains A, B)
GSHHHHHHHHMAKIEEGKLVIWINGDKGYNGLAEVGKKFEKDTGIKVTVEHPDKLEEKFP
QVAATGDGPDIIFWAHDRFGGYAQSGLLAEITPDKAFQDKLYPFTWDAVRYNGKLIAYPI
AVEALSLIYNKDLLPNPPKTWEEIPALDKELKAKGKSALMFNLQEPYFTWPLIAADGGYA
FKYENGKYDIKDVGVDNAGAKAGLTFLVDLIKNKHMNADTDYSIAEAAFNKGETAMTING
PWAWSNIDTSKVNYGVTVLPTFKGQPSKPFVGVLSAGINAASPNKELAKEFLENYLLTDE
GLEAVNKDKPLGAVALKSYEEELAKDPRIAATMENAQKGEIMPNIPQMSAFWYAVRTAVI
NAASGRQTVDEALKDAQTNAAAENLYFQGEFKTDSSFIMDSDPRRCMRHHYVDSISHPLY
KCSSKMVLLARCEGHCSQASRSEPLVSFSTVLKQPFRSSCHCCRPQTSKLKALRLRCSGG
MRLTATYRYILSCHCEECNS

Sequence of entity 2 (C, D), FASTA

>9MAN_2 Maltose/maltodextrin-binding periplasmic protein,Tetraspanin-12 (chains C, D)
GSHHHHHHHHMAKIEEGKLVIWINGDKGYNGLAEVGKKFEKDTGIKVTVEHPDKLEEKFP
QVAATGDGPDIIFWAHDRFGGYAQSGLLAEITPDKAFQDKLYPFTWDAVRYNGKLIAYPI
AVEALSLIYNKDLLPNPPKTWEEIPALDKELKAKGKSALMFNLQEPYFTWPLIAADGGYA
FKYENGKYDIKDVGVDNAGAKAGLTFLVDLIKNKHMNADTDYSIAEAAFNKGETAMTING
PWAWSNIDTSKVNYGVTVLPTFKGQPSKPFVGVLSAGINAASPNKELAKEFLENYLLTDE
GLEAVNKDKPLGAVALKSYEEELAKDPRIAATMENAQKGEIMPNIPQMSAFWYAVRTAVI
NAASGRQTVDEALKDAQTNAAAENLYFQGEFYEQELMVPVQWSDMVTLKARMTNYGLPRY
RWLTHAWNFFQREFKCCGVVYFTDWLEMTEMDWPPDSCCVREFPGCSKQAHQEDLSDLYQ
EGCGKKMYSFLRGTKQLQVLR

Primary citation

Structural basis of the interaction between Norrin-Tspan12. Xue, L., Zhang, M., Dai, Z. et al. Structure (2026) 34:1050-1060.e5. DOI 10.1016/j.str.2026.04.011 · PubMed

Other PDB entries of the same protein (UniProt P0AEY0 (AlphaFold model), which also has an AlphaFold model), best resolution first:

9PQP 1.07 Å, Crystal structure of maltose binding protein (Apo), mutant Trp340 to 4-Fluorotryptophan
9PQL 1.37 Å, Crystal structure of maltose binding protein (Apo), mutant Trp62 to 4-Fluorotryptophan
9PQN 1.37 Å, Crystal structure of maltose binding protein (Apo), mutant Trp340 to 4-Cyanotryptophan
9TY2 1.75 Å, Crystal structure of a Picomolar Nanobody in complex with Maltose Binding Protein, MBP,…
4WGI 1.85 Å, A Single Diastereomer of a Macrolactam Core Binds Specifically to Myeloid Cell Leukemia…
9PQK 1.87 Å, Crystal structure of maltose binding protein (Apo), mutant Trp10 to 4-Fluorotryptophan
4WVI 1.9 Å, Crystal structure of the Type-I signal peptidase from Staphylococcus aureus (SpsB) in…
4WVJ 1.95 Å, Crystal structure of the Type-I signal peptidase from Staphylococcus aureus (SpsB) in…
4YS9 2.0 Å, Ataxin-3 Carboxy-Terminal Region - Crystal C1 (tetragonal)
5II4 2.0 Å, Crystal structure of red abalone VERL repeat 1 with linker at 2.0 A resolution
5JON 2.04 Å, Crystal structure of the unliganded form of HCN2 CNBD
4WVG 2.05 Å, Crystal structure of the Type-I signal peptidase from Staphylococcus aureus (SpsB).

Browse structure collections

About this viewer

MolViewer shows 9MAN directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.