9MIV: Native tagless Lassa virus spike complex pH 6.0
Native tagless Lassa virus spike complex pH 6.0. Determined by electron microscopy at 2.02 Å resolution. Released 27 Aug 2025.
- Method
- Electron microscopy
- Resolution
- 2.02 Å
- Organisms
- Lassa virus Josiah, Homo sapiens
- Chains
- 12
- Atoms
- 16,936
- Mol. weight
- 339.76 kDa
- Ligands
- NAG
- Released
- 27 Aug 2025
Explore 9MIV in 3D
Show helices and sheets
RCSB PDB
PDBe
Secondary structure: helices and β-sheets
9MIV contains 65 α-helices and 129 β-strands across 12 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
Chains a and c: 8 helices, 9 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 264-269 | 6 | |
| β-strand | 278-280 | 3 | 1 |
| β-strand | 285 | 1 | 2 |
| β-strand | 291-293 | 3 | 1 |
| α-helix | 295-300 | 6 | |
| α-helix | 308-325 | 18 | |
| α-helix | 334-344 | 11 | |
| α-helix | 347-358 | 12 | |
| β-strand | 363 | 1 | 3 |
| β-strand | 368-374 | 7 | 4 |
| β-strand | 380 | 1 | 4 |
| α-helix | 381-383 | 3 | |
| β-strand | 384-385 | 2 | 4 |
| β-strand | 388-389 | 2 | 3 |
| β-strand | 392-393 | 2 | 3 |
| α-helix | 394-395 | 2 | |
| α-helix | 396-425 | 30 | |
Chain A: 9 helices, 10 β-strands
| Element | Residues | Length | Sheet |
|---|
| β-strand | 61-62 | 2 | 4 |
| β-strand | 66-72 | 7 | 4 |
| β-strand | 73 | 1 | 2 |
| α-helix | 75-78 | 4 | |
| β-strand | 84-87 | 4 | 5 |
| β-strand | 92-97 | 6 | 5 |
| β-strand | 101-108 | 8 | 5 |
| α-helix | 120-126 | 7 | |
| α-helix | 131-143 | 13 | |
| α-helix | 150-152 | 3 | |
| β-strand | 153-156 | 4 | 5 |
| α-helix | 158-160 | 3 | |
| β-strand | 163-167 | 5 | 5 |
| α-helix | 183-194 | 12 | |
| α-helix | 200-202 | 3 | |
| β-strand | 219-226 | 8 | 5 |
| β-strand | 237 | 1 | 5 |
| α-helix | 239-247 | 9 | |
| α-helix | 252-254 | 3 | |
Chain b: 10 helices, 9 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 264-269 | 6 | |
| β-strand | 278-280 | 3 | 27 |
| α-helix | 282-284 | 3 | |
| β-strand | 285 | 1 | 7 |
| β-strand | 291-293 | 3 | 27 |
| α-helix | 295-300 | 6 | |
| α-helix | 308-325 | 18 | |
| α-helix | 334-344 | 11 | |
| α-helix | 347-358 | 12 | |
| β-strand | 363 | 1 | 28 |
| β-strand | 368-374 | 7 | 6 |
| β-strand | 379-380 | 2 | 6 |
| α-helix | 381-383 | 3 | |
| β-strand | 384-385 | 2 | 6 |
| β-strand | 388-389 | 2 | 28 |
| β-strand | 392-393 | 2 | 28 |
| α-helix | 394-395 | 2 | |
| α-helix | 396-399 | 4 | |
| α-helix | 400-425 | 26 | |
Chain B: 9 helices, 10 β-strands
| Element | Residues | Length | Sheet |
|---|
| β-strand | 61-62 | 2 | 6 |
| β-strand | 66-72 | 7 | 6 |
| β-strand | 73 | 1 | 7 |
| α-helix | 75-78 | 4 | |
| β-strand | 84-87 | 4 | 8 |
| β-strand | 92-97 | 6 | 8 |
| β-strand | 101-108 | 8 | 8 |
| α-helix | 120-126 | 7 | |
| α-helix | 131-143 | 13 | |
| α-helix | 150-152 | 3 | |
| β-strand | 153-156 | 4 | 8 |
| α-helix | 158-160 | 3 | |
| β-strand | 163-167 | 5 | 8 |
| α-helix | 183-194 | 12 | |
| α-helix | 200-202 | 3 | |
| β-strand | 219-226 | 8 | 8 |
| β-strand | 237 | 1 | 8 |
| α-helix | 239-245 | 7 | |
| α-helix | 252-254 | 3 | |
Chain C: 9 helices, 10 β-strands
| Element | Residues | Length | Sheet |
|---|
| β-strand | 61-62 | 2 | 9 |
| β-strand | 66-72 | 7 | 9 |
| β-strand | 73 | 1 | 10 |
| α-helix | 75-78 | 4 | |
| β-strand | 84-87 | 4 | 11 |
| β-strand | 92-97 | 6 | 11 |
| β-strand | 101-108 | 8 | 11 |
| α-helix | 120-126 | 7 | |
| α-helix | 131-143 | 13 | |
| α-helix | 150-152 | 3 | |
| β-strand | 153-156 | 4 | 11 |
| α-helix | 158-160 | 3 | |
| β-strand | 163-167 | 5 | 11 |
| α-helix | 183-194 | 12 | |
| α-helix | 200-202 | 3 | |
| β-strand | 219-225 | 7 | 11 |
| β-strand | 237 | 1 | 11 |
| α-helix | 239-245 | 7 | |
| α-helix | 252-254 | 3 | |
Chain D: 3 helices, 12 β-strands
| Element | Residues | Length | Sheet |
|---|
| β-strand | 3-7 | 5 | 23 |
| β-strand | 11-12 | 2 | 24 |
| β-strand | 17-25 | 9 | 23 |
| β-strand | 33-39 | 7 | 19 |
| β-strand | 46-51 | 6 | 19 |
| β-strand | 57-59 | 3 | 19 |
| α-helix | 64-66 | 3 | |
| β-strand | 67-72 | 6 | 23 |
| β-strand | 77-83 | 7 | 23 |
| α-helix | 87-89 | 3 | |
| β-strand | 91-101 | 11 | 19 |
| α-helix | 107 | 1 | |
| β-strand | 108-114 | 7 | 19 |
| β-strand | 118-120 | 3 | 19 |
| β-strand | 121-122 | 2 | 24 |
Chains E and L: 1 helix, 12 β-strands
| Element | Residues | Length | Sheet |
|---|
| β-strand | 4-7 | 4 | 17 |
| β-strand | 10-12 | 3 | 18 |
| β-strand | 19-25 | 7 | 17 |
| β-strand | 32 | 1 | 19 |
| β-strand | 34-38 | 5 | 18 |
| β-strand | 45-49 | 5 | 18 |
| β-strand | 53-54 | 2 | 18 |
| β-strand | 62-67 | 6 | 17 |
| β-strand | 70-75 | 6 | 17 |
| α-helix | 80-82 | 3 | |
| β-strand | 85-92 | 8 | 18 |
| β-strand | 95-98 | 4 | 18 |
| β-strand | 102-105 | 4 | 18 |
Chain F: 2 helices, 12 β-strands
| Element | Residues | Length | Sheet |
|---|
| β-strand | 3-7 | 5 | 25 |
| β-strand | 11-12 | 2 | 26 |
| β-strand | 17-25 | 9 | 25 |
| β-strand | 33-39 | 7 | 22 |
| β-strand | 46-51 | 6 | 22 |
| β-strand | 57-59 | 3 | 22 |
| β-strand | 67-72 | 6 | 25 |
| β-strand | 77-83 | 7 | 25 |
| α-helix | 87-89 | 3 | |
| β-strand | 91-101 | 11 | 22 |
| α-helix | 107 | 1 | |
| β-strand | 108-114 | 7 | 22 |
| β-strand | 118-120 | 3 | 22 |
| β-strand | 121-122 | 2 | 26 |
2 more chain groups are not listed. Open the entry in the viewer and use the sequence panel to see them.
Molecules and chains
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|
| Glycoprotein G2 | a, b, c | protein | 232 | Lassa virus Josiah | P08669 (AlphaFold model) |
| Glycoprotein G1 | A, B, C | protein | 259 | Lassa virus Josiah | P08669 (AlphaFold model) |
| 12.1F Heavy chain | D, F, H | protein | 249 | Homo sapiens | |
| 12.1F Light chain | E, G, L | protein | 214 | Homo sapiens | |
Sequence of entity 1 (a, b, c), FASTA
>9MIV_1 Glycoprotein G2 (chains a, b, c)
GTFTWTLSDSEGKDTPGGYCLTRWMLIEAELKCFGNTAVAKCNEKHDEEFCDMLRLFDFN
KQAIQRLKAEAQMSIQLINKAVNALINDQLIMKNHLRDIMGIPYCNYSKYWYLNHTTTGR
TSLPKCWLVSNGSYLNETHFSDDIEQQADNMITEMLQKEYMERQGKTPLGLVDLFVFSTS
FYLISIFLHLVKIPTHRHIVGKSCPKPHRLNHMGICSCGLYKQPGVPVKWKR
Sequence of entity 2 (A, B, C), FASTA
>9MIV_2 Glycoprotein G1 (chains A, B, C)
MGQIVTFFQEVPHVIEEVMNIVLIALSVLAVLKGLYNFATCGLVGLVTFLLLCGRSCTTS
LYKGVYELQTLELNMETLNMTMPLSCTKNNSHHYIMVGNETGLELTLTNTSIINHKFCNL
SDAHKKNLYDHALMSIISTFHLSIPNFNQYEAMSCDFNGGKISVQYNLSHSYAGDAANHC
GTVANGVLQTFMRMAWGGSYIALDSGRGNWDCIMTSYQYLIIQNTTWEDHCQFSRPSPIG
YLGLLSQRTRDIYISRRLL
Sequence of entity 3 (D, F, H), FASTA
>9MIV_3 12.1F Heavy chain (chains D, F, H)
QVQLQESGAGLLKPSETLSLSCTVDGESFNGFFWTWIRQPPGKGLEWIGEINHLASTGYN
PSLKSRVTISVDTSKNQFSLKLTSVTAADTAVYYCARGYSYGFAWPNYHYLDVWGKGTTV
TVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAV
LQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRVEPKSCDKTHGGDYKDDDD
KGTENLYFQ
Sequence of entity 4 (E, G, L), FASTA
>9MIV_4 12.1F Light chain (chains E, G, L)
EIVLTQSPATLSLSPGERATLSCRASQSVSSYLAWYQHKPGQAPRLLIYGASKRATGIPS
RFSGSGSGTDFSLTISSLEPEDFAVYYCQHRSDWRTTFGQGTRLEIKRTVAAPSVFIFPP
SDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLT
LSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC
Ligands and cofactors
| ID | Name | Formula | Copies |
|---|
| NAG | 2-acetamido-2-deoxy-beta-D-glucopyranose | C8 H15 N O6 | 12 |
Water and common crystallization additives (UNX) are not listed.
Primary citation
pH-induced conformational changes and inhibition of the Lassa virus spike complex. Katz, M., Cohen-Dvashi, H., Borni, S. et al. Cell Host Microbe (2025) 33:1577-1588.e7. DOI 10.1016/j.chom.2025.07.020 · PubMed
Other PDB entries of the same protein (UniProt P08669 (AlphaFold model), which also has an AlphaFold model), best resolution first:
- 9MJ1 1.9 Å, Native tagless Lassa virus spike complex bound at pH 8.0
- 9MHE 2.01 Å, Native tagless Lassa virus spike complex bound to ARN-75039 at pH 8.0
- 5OMI 2.56 Å, Crystal structure of GP2 from Lassa virus in a post fusion conformation
- 9MJ2 2.58 Å, Flag-tag Lassa virus spike complex at pH 6.0
- 4ZJF 2.6 Å, Crystal structure of GP1 - the receptor binding domain of Lassa virus
- 7S8H 2.7 Å, Structure of Lassa virus glycoprotein bound to Fab 18.5C and Fab 36.1F
- 9MIY 2.72 Å, Focused reconstruction of the transmembrane region of the Lassa virus spike complex
- 7UOV 2.75 Å, Native Lassa glycoprotein in complex with neutralizing antibodies 12.1F and 37.2D
- 7UOT 2.77 Å, Native Lassa glycoprotein in complex with neutralizing antibodies 8.9F and 37.2D
- 7TYV 2.8 Å, Structure of Lassa Virus glycoprotein (Josiah) bound to Fab 25.10C
- 8VCV 2.8 Å, Lineage IV Lassa virus glycoprotein (Josiah) in complex with rabbit polyclonal antibody…
- 8VE8 2.8 Å, Lineage IV Lassa virus glycoprotein (Josiah) in complex with rabbit polyclonal antibody…
Browse structure collections
About this viewer
MolViewer shows 9MIV directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.