9MJS: WRN helicase with bound AMPPNP

Crystal structure of WRN helicase with bound AMPPNP. Determined by X-ray diffraction at 1.84 Å resolution. Released 14 Jan 2026.

Method: X-ray diffraction
Resolution: 1.84 Å
Organism: Homo sapiens
Chains: 1
Atoms: 3,593
Mol. weight: 51.05 kDa
Ligands: ZN, ANP
Released: 14 Jan 2026

Explore 9MJS in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

9MJS contains 24 α-helices and 16 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 24 helices, 16 β-strands

Element	Residues	Length	Sheet
α-helix	531-533	3
α-helix	534-544	11
α-helix	551-563	13
β-strand	567-570	4	1
α-helix	578-588	11
β-strand	591-595	5	1
α-helix	599-611	13
β-strand	616-618	3	1
α-helix	627-632	6
β-strand	638-641	4	1
α-helix	643-648	6
α-helix	650-659	10
β-strand	662-668	7	1
α-helix	680-687	8
α-helix	690-693	4
α-helix	698	1
β-strand	699-702	4	1
α-helix	708-718	11
β-strand	724-727	4	1
β-strand	735-741	7	2
α-helix	746-750	5
α-helix	751-753	3
β-strand	754-757	4	3
β-strand	760-763	4	3
β-strand	767-770	4	2
α-helix	774-786	13
β-strand	791-794	4	2
α-helix	800-811	12
β-strand	817-820	4	2
α-helix	826-828	3
β-strand	835-839	5	2
α-helix	845-852	8
β-strand	862-868	7	2
α-helix	873-875	3
α-helix	877-879	3
α-helix	886-904	19
α-helix	909-918	10
α-helix	924-926	3
β-strand	936	1	2
α-helix	937-940	4

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Bifunctional 3'-5' exonuclease/ATP-dependent helicase WRN	A	protein	443	Homo sapiens	Q14191 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>9MJS_1 Bifunctional 3'-5' exonuclease/ATP-dependent helicase WRN (chains A)
NLGLPTKEEEEDDENEANEGEEDDDKDFLWPAPNEEQVTCLKMYFGHSSFKPVQWKVIHS
VLEERRDNVAVMATGYGKSLCFQYPPVYVGKIGLVISPLISLMEDQVLQLKMSNIPACFL
GSAQSENVLTDIKLGKYRIVYVTPEYCSGNMGLLQQLEADIGITLIAVDEAHCISEWGHD
FRDSFRKLGSLKTALPMVPIVALTATASSSIREDIVRCLNLRNPQITCTGFDRPNLYLEV
RRKTGNILQDLQPFLVKTSSHWEFEGPTIIYCPSRKMTQQVTGELRKLNLSCGTYHAGMS
FSTRKDIHHRFVRDEIQCVIATIAFGMGINKADIRQVIHYGAPKDMESYYQEIGRAGRDG
LQSSCHVLWAPADINLNRHLLTEIRNEKFRLYKLKMMAKMEKYLHSSRCRRQIILSHFED
KQVQKASLGIMGTEKCCDNCRSR

Ligands and cofactors

ID	Name	Formula	Copies
ZN	Zinc ion	Zn	1
ANP	Phosphoaminophosphonic acid-adenylate ester	C10 H17 N6 O12 P3	1

Primary citation

WRN structural flexibility showcased through fragment-based lead discovery of inhibitors. Palte, R.L., Mandal, M., Sikorska, J. et al. Nat Commun (2026) 17:79-79. DOI 10.1038/s41467-025-66768-8 · PubMed

Other PDB entries of the same protein (UniProt Q14191 (AlphaFold model), which also has an AlphaFold model), best resolution first:

10AK 1.37 Å, Crystal Structure of Human WRN helicase with compound 4
7GQU 1.54 Å, Crystal Structure of Werner helicase fragment 517-945 in covalent complex with…
9OWB 1.56 Å, Human WRN helicase in complex with allosteric ligand Compound 6
7GQS 1.57 Å, Crystal Structure of Werner helicase fragment 517-945 in complex with ADP
9MJU 1.58 Å, Crystal structure of WRN helicase with allosteric fragment 1
7XUT 1.6 Å, Crystal structure of RPA70N-WRN fusion
8PFP 1.6 Å, Crystal structure of WRN helicase domain in complex with ATPgammaS
9MJY 1.63 Å, Crystal structure of WRN helicase with bound allosteric compound 1
9OG8 1.66 Å, Crystal structure of WRN in complex with compound 43
9OWC 1.67 Å, Human WRN helicase in complex with allosteric ligand Compound 7
9MJZ 1.7 Å, Crystal structure of WRN helicase with bound allosteric compound 3
9MJT 1.73 Å, Crystal structure of apo WRN helicase in Form D

Browse structure collections

About this viewer

MolViewer shows 9MJS directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.