Crystal structure of WRN helicase with bound allosteric compound 3. Determined by X-ray diffraction at 1.7 Å resolution. Released 14 Jan 2026.
Explore 9MJZ in 3D Show helices and sheets RCSB PDB PDBe
9MJZ contains 26 α-helices and 16 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 531-533 | 3 | |
| α-helix | 534-544 | 11 | |
| α-helix | 551-558 | 8 | |
| α-helix | 559-563 | 5 | |
| β-strand | 567-570 | 4 | 1 |
| α-helix | 575-588 | 14 | |
| β-strand | 591-595 | 5 | 1 |
| α-helix | 599-611 | 13 | |
| β-strand | 616-618 | 3 | 1 |
| α-helix | 624-632 | 9 | |
| β-strand | 638-641 | 4 | 1 |
| α-helix | 643-647 | 5 | |
| α-helix | 650-659 | 10 | |
| β-strand | 662-667 | 6 | 1 |
| α-helix | 670-673 | 4 | |
| α-helix | 682-689 | 8 | |
| α-helix | 690-693 | 4 | |
| β-strand | 699-703 | 5 | 1 |
| α-helix | 708-717 | 10 | |
| α-helix | 723 | 1 | |
| β-strand | 724-727 | 4 | 1 |
| β-strand | 735-741 | 7 | 2 |
| α-helix | 742-743 | 2 | |
| α-helix | 746-750 | 5 | |
| α-helix | 751-753 | 3 | |
| β-strand | 755-756 | 2 | 3 |
| β-strand | 761-762 | 2 | 3 |
| β-strand | 767-770 | 4 | 2 |
| α-helix | 774-785 | 12 | |
| β-strand | 791-794 | 4 | 2 |
| α-helix | 800-811 | 12 | |
| β-strand | 817-820 | 4 | 2 |
| β-strand | 835-839 | 5 | 2 |
| α-helix | 845-852 | 8 | |
| β-strand | 862-868 | 7 | 2 |
| α-helix | 873-875 | 3 | |
| α-helix | 877-879 | 3 | |
| α-helix | 886-904 | 19 | |
| α-helix | 909-917 | 9 | |
| α-helix | 920-923 | 4 | |
| β-strand | 936 | 1 | 2 |
| α-helix | 937-940 | 4 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Bifunctional 3'-5' exonuclease/ATP-dependent helicase WRN | A | protein | 443 | Homo sapiens | Q14191 (AlphaFold model) |
>9MJZ_1 Bifunctional 3'-5' exonuclease/ATP-dependent helicase WRN (chains A) NLGLPTKEEEEDDENEANEGEEDDDKDFLWPAPNEEQVTCLKMYFGHSSFKPVQWKVIHS VLEERRDNVAVMATGYGKSLCFQYPPVYVGKIGLVISPLISLMEDQVLQLKMSNIPACFL GSAQSENVLTDIKLGKYRIVYVTPEYCSGNMGLLQQLEADIGITLIAVDEAHCISEWGHD FRDSFRKLGSLKTALPMVPIVALTATASSSIREDIVRCLNLRNPQITCTGFDRPNLYLEV RRKTGNILQDLQPFLVKTSSHWEFEGPTIIYCPSRKMTQQVTGELRKLNLSCGTYHAGMS FSTRKDIHHRFVRDEIQCVIATIAFGMGINKADIRQVIHYGAPKDMESYYQEIGRAGRDG LQSSCHVLWAPADINLNRHLLTEIRNEKFRLYKLKMMAKMEKYLHSSRCRRQIILSHFED KQVQKASLGIMGTEKCCDNCRSR
| ID | Name | Formula | Copies |
|---|---|---|---|
| ZN | Zinc ion | Zn | 1 |
| A1BL6 | (2-anilino-5-{[4-(trifluoromethyl)phenyl]carbamoyl}-1,3-thiazol-4-yl)acetic acid | C19 H14 F3 N3 O3 S | 1 |
Water and common crystallization additives (EDO, GOL, DMS) are not listed.
WRN structural flexibility showcased through fragment-based lead discovery of inhibitors. Palte, R.L., Mandal, M., Sikorska, J. et al. Nat Commun (2026) 17:79-79. DOI 10.1038/s41467-025-66768-8 · PubMed
Other PDB entries of the same protein (UniProt Q14191 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 9MJZ directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.