9N7E: Eptesicus fuscus ACE2 peptidase domain

Eptesicus fuscus ACE2 peptidase domain bound to VsCoV-a7 RBD complex. Determined by electron microscopy at 2.5 Å resolution. Released 27 Aug 2025.

Method: Electron microscopy
Resolution: 2.5 Å
Organisms: Eptesicus fuscus, Merbecovirus
Chains: 2
Atoms: 7,050
Mol. weight: 122.26 kDa
Ligands: ZN, NAG
Released: 27 Aug 2025

Explore 9N7E in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

9N7E contains 54 α-helices and 30 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 43 helices, 17 β-strands

Element	Residues	Length	Sheet
α-helix	20-51	32
α-helix	56-80	25
α-helix	85-87	3
α-helix	91-100	10
α-helix	104-107	4
α-helix	110-128	19
β-strand	131-133	3	1
β-strand	141-143	3	1
α-helix	144-153	10
α-helix	157-167	11
α-helix	168-172	5
α-helix	173-192	20
α-helix	198-202	5
α-helix	203-205	3
β-strand	208	1	2
β-strand	216	1	2
α-helix	219-250	32
β-strand	259	1	3
α-helix	260	1
β-strand	261-262	2	4
α-helix	263-265	3
α-helix	275-277	3
α-helix	278-281	4
α-helix	288-290	3
α-helix	293-298	6
α-helix	303-316	14
α-helix	324-329	6
β-strand	331	1	5
β-strand	346-349	4	5
β-strand	355-358	4	5
α-helix	365-383	19
α-helix	389-391	3
α-helix	399-411	13
α-helix	414-419	6
α-helix	431-445	15
α-helix	449-464	16
α-helix	469-471	3
α-helix	472-479	8
α-helix	480-484	5
β-strand	486-487	2	4
α-helix	499-501	3
α-helix	503-506	4
α-helix	513-531	19
α-helix	538-540	3
α-helix	547-557	11
α-helix	565-573	9
α-helix	581-586	6
α-helix	588-598	11
β-strand	613	1	3
α-helix	620-622	3
β-strand	624-626	3	6
α-helix	643-663	21
β-strand	676-682	7	6
β-strand	686-691	6	6
β-strand	692	1	7
β-strand	700	1	7
α-helix	701-702	2
α-helix	703-712	10
α-helix	714-717	4
β-strand	730	1	6

Chain B: 11 helices, 13 β-strands

Element	Residues	Length	Sheet
α-helix	360-362	3
α-helix	370-372	3
β-strand	374-378	5	8
β-strand	382-383	2	9
α-helix	385-390	6
β-strand	396-400	5	8
α-helix	404-409	6
β-strand	412	1	10
β-strand	414-421	8	8
α-helix	424-426	3
α-helix	428-430	3
α-helix	437	1
α-helix	438-442	5
β-strand	451-457	7	8
α-helix	464-467	4
β-strand	469-480	12	11
β-strand	483-486	4	11
α-helix	488-490	3
α-helix	498-501	4
β-strand	510-514	5	11
β-strand	519-527	9	11
β-strand	533-541	9	8
β-strand	549	1	10
β-strand	550-551	2	9

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Angiotensin-converting enzyme 2	A	protein	773	Eptesicus fuscus	Q56H28 (AlphaFold model)
VsCoV-a7-S RBD	B	protein	270	Merbecovirus	A3EXD0 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>9N7E_1 Angiotensin-converting enzyme 2 (chains A)
MSGSSWLFLSLVAVTAAQSTTEKNATIFLENFNSEAEDLSHESALASWNYNTNITDENAQ
KMNEADSKWSAFYEKQSKLAQTYPLQEIQNLTIKLQLQVLQQNGSSVLTADKSKRLSTIL
TTMSTIYSTGKVCNPNNPQECLTLSGLEDIMEKSKDYNQRLWVWEGWRSEVGKQLRPLYE
EYVVLKNEMARGNNYEDYGDYWRGDYETEGENGYNYSRSQLTEDVDRIFLEIKPLYEHLH
AYVRAKLMDTYPSRISPTGCLPAHLLGDMWGRFWTNLYNLTVPFEQKPNIDVTDAMKEQS
WDAEKIFKEAEKFYMSVGLPSMTPGFWNNSMLTEPGDGRKVVCHPTAWDLGKNDFRIKMC
TKVTMDDFLTAHHEMGHIQYDMAYATQPYLLRNGANEGFHEAVGEVMSLSVATPKHLKGM
GLLPSDFSEDNETEINFLLKQALNIVGTLPFTYMLEKWRWMVFKGEIPKEQWMKKWWEMK
REIVGVVEPLPHDETYCDPASLFHVANDYSFIRYFTRTIFEFQFQEALCQIAKHQGPLHK
CDISNSTEAGNKLLEMLKLGKSKPWTFALEKITGTKKMDAKPLLNYFEPLFTWLKEQNGN
SVGWHSGNYVGWSSDWSPYADQSIKVRISLKSALGEKAYEWNDNEMYLFRSSVAYAMREY
FLKVKNQTIPFRAEDVWVNDVKPRVSFKFFVTSPTNMSDIIPRSEVEDAIRMSRSRINAA
FRLDDNSLEFLGIQPTLGPPYQPPVTIGLNDIFEAQKIEWHEGGSHHHHHHHH

Sequence of entity 2 (B), FASTA

>9N7E_2 VsCoV-a7-S RBD (chains B)
MGILPSPGMPALLSLVSLLSVLLMGCVAETGTECDFTSMLTAVPPQVYNFSRLVFTNCNY
NLTKLLSLFQVTEFSCHQVSPDALASGCYSSLTVDYFAYPSYLASYLHPGSTGEIAQYNY
KQDFSNPTCRILATVPANLTIPKPARYMWLTQCYSYSAFGNTPLYVKPSQYTPCLSLASQ
GFDADSQTHRDTVNKMAATGRIAAMSGNLQMAFVISVQYGTDANSVCPMQAVRLVPRGSS
SGGSGLNDIFEAQKIEWHEGGSHHHHHHHH

Ligands and cofactors

ID	Name	Formula	Copies
ZN	Zinc ion	Zn	1
NAG	2-acetamido-2-deoxy-beta-D-glucopyranose	C8 H15 N O6	7

Primary citation

ACE2 utilization of HKU25 clade MERS-related coronaviruses with broad geographic distribution. Liu, C., Park, Y.J., Ma, C.B. et al. bioRxiv (2025). DOI 10.1101/2025.02.19.639017 · PubMed

Other PDB entries of the same protein (UniProt Q56H28 (AlphaFold model), which also has an AlphaFold model), best resolution first:

9DAK 2.4 Å, Merbecovirus PnNL2018B Spike glycoprotein RBD bound to the P. Nathusii ACE2
9C6O 2.77 Å, Merbecovirus MOW15-22 Spike glycoprotein RBD bound to the P. davyi ACE2
9KWY 2.82 Å, Cryo-EM structure of SARS-CoV-2 RBD in complex with ACE2 and mAb 1C4
7C8D 3.0 Å, Cryo-EM structure of cat ACE2 and SARS-CoV-2 RBD
8ZUF 3.31 Å, Cryo-EM structure of P.nat ACE2 mutant in complex with MOW15-22 RBD

Browse structure collections

About this viewer

MolViewer shows 9N7E directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.