9NCY: Fab1392

Fab1392 in complex with the C-terminal alpha-TSR domain of the P. falciparum circumsporozoite protein. Determined by X-ray diffraction at 1.63 Å resolution. Released 11 Mar 2026.

Method: X-ray diffraction
Resolution: 1.63 Å
Organisms: Homo sapiens, Plasmodium falciparum 3D7
Chains: 3
Atoms: 4,391
Mol. weight: 58.33 kDa
Released: 11 Mar 2026

Explore 9NCY in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

9NCY contains 22 α-helices and 47 β-strands across 3 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 5 helices, 2 β-strands

Element	Residues	Length	Sheet
α-helix	313-323	11
α-helix	324-326	3
α-helix	331-334	4
β-strand	340-346	7	12
α-helix	347	1
α-helix	355-360	6
β-strand	364-370	7	12

Chain H: 9 helices, 24 β-strands

Element	Residues	Length	Sheet
β-strand	2-7	6	1
β-strand	11-12	2	2
β-strand	18-26	9	1
β-strand	33-40	8	3
β-strand	44-51	8	3
β-strand	57-59	3	3
α-helix	64-66	3
β-strand	67-72	6	1
β-strand	77-82	6	1
α-helix	84-86	3
β-strand	88-100	13	3
β-strand	100E-103	10	3
β-strand	107-109	3	3
β-strand	110-111	2	2
α-helix	115-116	2
β-strand	117	1	4
α-helix	118-119	2
β-strand	120-124	5	5
α-helix	128-130	3
β-strand	131-132	2	5
β-strand	135-145	11	5
β-strand	146	1	4
β-strand	151-154	4	6
α-helix	155-157	3
β-strand	159	1	6
β-strand	163-165	3	5
α-helix	166-168	3
β-strand	169-170	2	5
β-strand	176-185	10	5
α-helix	186-190	5
β-strand	195-200	6	6
α-helix	201-203	3
β-strand	205-210	6	6

Chain L: 8 helices, 21 β-strands

Element	Residues	Length	Sheet
β-strand	5-6	2	7
β-strand	10-14	5	8
β-strand	19-25	7	7
β-strand	34-38	5	8
β-strand	45-49	5	8
β-strand	53-54	2	8
α-helix	55	1
β-strand	62-66	5	7
β-strand	70-75	6	7
α-helix	80-82	3
β-strand	84-92	9	8
β-strand	94-98	4	8
β-strand	102-107	6	8
β-strand	111	1	9
α-helix	112-113	2
β-strand	114-118	5	10
α-helix	119-121	3
α-helix	122-125	4
β-strand	129-139	11	10
β-strand	140	1	9
β-strand	144-150	7	11
β-strand	153-154	2	11
α-helix	155	1
β-strand	159-163	5	10
α-helix	164-167	4
β-strand	173-182	10	10
α-helix	183-188	6
β-strand	191-198	8	11
β-strand	205-210	6	11

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Fab1392 heavy chain	H	protein	230	Homo sapiens
Fab1392 light chain	L	protein	213	Homo sapiens
Circumsporozoite protein	A	protein	73	Plasmodium falciparum 3D7	Q7K740 (AlphaFold model)

Sequence of entity 1 (H), FASTA

>9NCY_1 Fab1392 heavy chain (chains H)
QVQLQESGPGLVRSSETLSLTCTVSGDSMRRYFRNWIRQSPGRGLEWIGAIFDNGSTRYN
PSLKSRVTMSVDVSKNQFSLRLSSVTAADTAVYYCARARDYYDFLTRTYRNFYFDYWGQG
TLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTF
PAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSC

Sequence of entity 2 (L), FASTA

>9NCY_2 Fab1392 light chain (chains L)
DIQMTQSPSSLSASVGERVIITCQASQDINHYLNWYQQKPGTAPKLLIYDASKLETGVPS
RFSGSGSGTDFTFTIASLQPEDFATYYCQHYDLYPLFGGGTKVDVKRTVAAPSVFIFPPS
DEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTL
SKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC

Sequence of entity 3 (A), FASTA

>9NCY_3 Circumsporozoite protein (chains A)
EPSDKHIKEYLNKIQNSLSTEWSPCSVTCGNGIQVRIKPGSANKPKDELDYANDIEKKIC
KMEKCSSHHHHHH

Primary citation

Fab1392 in complex with the C-terminal alpha-TSR domain of the P. falciparum circumsporozoite protein. Moskovitz, R., Wilson, I.A. To be published.

Other PDB entries of the same protein (UniProt Q7K740 (AlphaFold model), which also has an AlphaFold model), best resolution first:

7SG5 1.4 Å, Structure of PfCSP peptide 21 with antibody CIS43_Var2
9C79 1.46 Å, Human monoclonal antibody MAD21-101 bound to the N-terminus of cleaved circumsporozoite…
9NKZ 1.48 Å, Crystal structure of Fab MAM01 in complex with NANP6 peptide from circumsporozoite protein
9NL0 1.54 Å, Crystal structure of Fab MAM01 in complex with NPNA3 peptide from circumsporozoite protein
7SG6 1.55 Å, Structure of PfCSP peptide 21 with antibody CIS43_Var10
6PBV 1.57 Å, Crystal structure of Fab668 complex
3VDJ 1.7 Å, Crystal structure of circumsporozoite protein aTSR domain, R32 native form
9DST 1.74 Å, Crystal structure of Fab MS-1805 in complex with N-terminal junction peptide from…
9NI1 1.75 Å, Fab389 in complex with the C-terminal alpha-TSR domain of the P. falciparum…
7RXP 1.76 Å, Fab1512 in complex with the C-terminal alpha-TSR domain of P. falciparum
6BQB 1.77 Å, MGG4 Fab in complex with peptide
7LKB 1.8 Å, Crystal structure of PfCSP peptide 21 with vaccine-elicited human anti-malaria antibody…

Browse structure collections

About this viewer

MolViewer shows 9NCY directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.