Structure of J-PKAc chimera in complex with Aplithianine j1. Determined by X-ray diffraction at 2.45 Å resolution. Released 4 Mar 2026.
Explore 9NFS in 3D Show helices and sheets RCSB PDB PDBe
9NFS contains 46 α-helices and 28 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 17-28 | 12 | |
| α-helix | 40-55 | 16 | |
| α-helix | 57-86 | 30 | |
| α-helix | 95-97 | 3 | |
| β-strand | 98-106 | 9 | 2 |
| β-strand | 110-117 | 8 | 2 |
| β-strand | 123-130 | 8 | 2 |
| α-helix | 131-136 | 6 | |
| α-helix | 140-152 | 13 | |
| β-strand | 158 | 1 | 3 |
| β-strand | 161-166 | 6 | 2 |
| β-strand | 170-176 | 7 | 2 |
| α-helix | 177 | 1 | |
| β-strand | 182 | 1 | 3 |
| α-helix | 183-190 | 8 | |
| α-helix | 195-214 | 20 | |
| β-strand | 217-218 | 2 | 4 |
| α-helix | 224-226 | 3 | |
| β-strand | 227-229 | 3 | 3 |
| β-strand | 235-237 | 3 | 3 |
| β-strand | 244-245 | 2 | 4 |
| β-strand | 250 | 1 | 5 |
| α-helix | 257-259 | 3 | |
| α-helix | 262-265 | 4 | |
| β-strand | 270 | 1 | 5 |
| α-helix | 273-287 | 15 | |
| α-helix | 298-307 | 10 | |
| α-helix | 318-327 | 10 | |
| α-helix | 344-347 | 4 | |
| α-helix | 350-352 | 3 | |
| α-helix | 357-361 | 5 | |
| α-helix | 391-393 | 3 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 4-7 | 4 | |
| α-helix | 17-29 | 13 | |
| α-helix | 44-55 | 12 | |
| α-helix | 57-63 | 7 | |
| α-helix | 65-86 | 22 | |
| α-helix | 95-97 | 3 | |
| β-strand | 98-107 | 10 | 6 |
| β-strand | 110-117 | 8 | 6 |
| β-strand | 123-130 | 8 | 6 |
| α-helix | 131-136 | 6 | |
| α-helix | 140-150 | 11 | |
| β-strand | 158 | 1 | 7 |
| α-helix | 159-160 | 2 | |
| β-strand | 161-166 | 6 | 6 |
| β-strand | 170-176 | 7 | 6 |
| α-helix | 177 | 1 | |
| β-strand | 182 | 1 | 7 |
| α-helix | 183-187 | 5 | |
| α-helix | 195-214 | 20 | |
| β-strand | 217-218 | 2 | 8 |
| α-helix | 224-226 | 3 | |
| β-strand | 227-229 | 3 | 7 |
| β-strand | 235-237 | 3 | 7 |
| β-strand | 244-245 | 2 | 8 |
| β-strand | 250 | 1 | 9 |
| β-strand | 255 | 1 | 1 |
| α-helix | 257-259 | 3 | |
| α-helix | 262-265 | 4 | |
| β-strand | 270 | 1 | 9 |
| α-helix | 273-288 | 16 | |
| α-helix | 298-307 | 10 | |
| α-helix | 318-327 | 10 | |
| α-helix | 332-334 | 3 | |
| α-helix | 344-347 | 4 | |
| α-helix | 350-352 | 3 | |
| α-helix | 357-361 | 5 | |
| α-helix | 379-381 | 3 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 6-12 | 7 | |
| α-helix | 18-22 | 5 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 6-12 | 7 | |
| α-helix | 14-16 | 3 | |
| β-strand | 22 | 1 | 1 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| cAMP-dependent protein kinase inhibitor alpha | C, D | protein | 20 | Homo sapiens | P61925 (AlphaFold model) |
| DnaJ homolog subfamily B member 1,cAMP-dependent protein kinase catalytic subunit alpha | A, B | protein | 405 | Homo sapiens | P17612 (AlphaFold model), P25685 (AlphaFold model) |
>9NFS_1 cAMP-dependent protein kinase inhibitor alpha (chains C, D) TTYADFIASGRTGRRNAIHD
>9NFS_2 DnaJ homolog subfamily B member 1,cAMP-dependent protein kinase catalytic subunit alpha (chains A, B) GKDYYQTLGLARGASDEEIKRAYRRQALRYHPDKNKEPGAEEKFKEIAEAYDVLSDPRKR EIFDRYGEEVKEFLAKAKEDFLKKWESPAQNTAHLDQFERIKTLGTGSFGRVMLVKHKET GNHYAMKILDKQKVVKLKQIEHTLNEKRILQAVNFPFLVKLEFSFKDNSNLYMVMEYVPG GEMFSHLRRIGRFSEPHARFYAAQIVLTFEYLHSLDLIYRDLKPENLLIDQQGYIQVTDF GFAKRVKGRTWTLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFFADQPIQ IYEKIVSGKVRFPSHFSSDLKDLLRNLLQVDLTKRFGNLKNGVNDIKNHKWFATTDWIAI YQRKVEAPFIPKFKGPGDTSNFDDYEEEEIRVSINEKCGKEFSEF
| ID | Name | Formula | Copies |
|---|---|---|---|
| A1BX1 | (4P)-4-[4-(pyrimidin-4-yl)-3,4-dihydro-2H-1,4-thiazin-6-yl]-1H-pyrrolo[2,3-b]py… | C15 H13 N5 S | 2 |
Structure of J-PKAc chimera in complex with Aplithianine j1. Martinez Fiesco, J.A., Zhang, P. To be published.
Other PDB entries of the same protein (UniProt P61925 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 9NFS directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.