9NI1: Fab389
Fab389 in complex with the C-terminal alpha-TSR domain of the P. falciparum circumsporozoite protein. Determined by X-ray diffraction at 1.75 Å resolution. Released 9 Sept 2026.
- Method
- X-ray diffraction
- Resolution
- 1.75 Å
- Organisms
- Homo sapiens, Plasmodium falciparum 3D7
- Chains
- 6
- Atoms
- 8,462
- Mol. weight
- 112.94 kDa
- Released
- 9 Sept 2026
Explore 9NI1 in 3D
Show helices and sheets
RCSB PDB
PDBe
Secondary structure: helices and β-sheets
9NI1 contains 49 α-helices and 95 β-strands across 6 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
Chain A: 12 helices, 26 β-strands
| Element | Residues | Length | Sheet |
|---|
| β-strand | 3-7 | 5 | 12 |
| β-strand | 10-12 | 3 | 13 |
| β-strand | 18-25 | 8 | 12 |
| α-helix | 29-31 | 3 | |
| β-strand | 33-39 | 7 | 13 |
| β-strand | 45-51 | 7 | 13 |
| α-helix | 53-55 | 3 | |
| β-strand | 58-60 | 3 | 13 |
| α-helix | 62-64 | 3 | |
| β-strand | 68-73 | 6 | 12 |
| α-helix | 74-76 | 3 | |
| β-strand | 78-83 | 6 | 12 |
| α-helix | 88-90 | 3 | |
| β-strand | 92-100 | 9 | 13 |
| β-strand | 101 | 1 | 14 |
| β-strand | 110-114 | 5 | 13 |
| β-strand | 118-122 | 5 | 13 |
| α-helix | 125-127 | 3 | |
| β-strand | 128 | 1 | 15 |
| α-helix | 129-130 | 2 | |
| β-strand | 131-135 | 5 | 16 |
| α-helix | 139-141 | 3 | |
| β-strand | 142-143 | 2 | 16 |
| β-strand | 146-156 | 11 | 16 |
| β-strand | 157 | 1 | 15 |
| β-strand | 162-165 | 4 | 17 |
| α-helix | 166-168 | 3 | |
| β-strand | 170 | 1 | 17 |
| β-strand | 174-176 | 3 | 16 |
| α-helix | 177-179 | 3 | |
| β-strand | 180-181 | 2 | 16 |
| β-strand | 187-196 | 10 | 16 |
| α-helix | 197-199 | 3 | |
| β-strand | 200 | 1 | 18 |
| β-strand | 203 | 1 | 18 |
| β-strand | 206-211 | 6 | 17 |
| α-helix | 212-214 | 3 | |
| β-strand | 216-221 | 6 | 17 |
Chain B: 5 helices, 2 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 313-322 | 10 | |
| α-helix | 331-334 | 4 | |
| β-strand | 340-346 | 7 | 14 |
| α-helix | 348-350 | 3 | |
| α-helix | 355-357 | 3 | |
| α-helix | 360-363 | 4 | |
| β-strand | 364-370 | 7 | 14 |
Chain C: 6 helices, 2 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 313-322 | 10 | |
| α-helix | 331-334 | 4 | |
| β-strand | 340-346 | 7 | 3 |
| α-helix | 348-350 | 3 | |
| α-helix | 355-357 | 3 | |
| α-helix | 360-363 | 4 | |
| β-strand | 364-370 | 7 | 3 |
| α-helix | 371-373 | 3 | |
Chain D: 7 helices, 21 β-strands
| Element | Residues | Length | Sheet |
|---|
| β-strand | 4-7 | 4 | 19 |
| β-strand | 10-13 | 4 | 20 |
| β-strand | 19-25 | 7 | 19 |
| β-strand | 33-38 | 6 | 20 |
| β-strand | 45-49 | 5 | 20 |
| β-strand | 53-54 | 2 | 20 |
| α-helix | 55 | 1 | |
| β-strand | 62-67 | 6 | 19 |
| β-strand | 70-75 | 6 | 19 |
| α-helix | 80-82 | 3 | |
| β-strand | 84-90 | 7 | 20 |
| β-strand | 99 | 1 | 20 |
| β-strand | 103-107 | 5 | 20 |
| β-strand | 112 | 1 | 21 |
| α-helix | 113-114 | 2 | |
| β-strand | 115-119 | 5 | 22 |
| α-helix | 120-122 | 3 | |
| α-helix | 123-127 | 5 | |
| β-strand | 130-140 | 11 | 22 |
| β-strand | 141 | 1 | 21 |
| β-strand | 146-151 | 6 | 23 |
| β-strand | 154-155 | 2 | 23 |
| β-strand | 160-164 | 5 | 22 |
| α-helix | 165-168 | 4 | |
| β-strand | 174-183 | 10 | 22 |
| α-helix | 184-188 | 5 | |
| β-strand | 192-198 | 7 | 23 |
| β-strand | 206-211 | 6 | 23 |
Chain H: 11 helices, 23 β-strands
| Element | Residues | Length | Sheet |
|---|
| β-strand | 3-7 | 5 | 1 |
| β-strand | 10-12 | 3 | 2 |
| β-strand | 18-25 | 8 | 1 |
| α-helix | 29-31 | 3 | |
| β-strand | 33-39 | 7 | 2 |
| β-strand | 45-51 | 7 | 2 |
| α-helix | 53-55 | 3 | |
| β-strand | 58-60 | 3 | 2 |
| α-helix | 62-64 | 3 | |
| β-strand | 68-73 | 6 | 1 |
| β-strand | 78-83 | 6 | 1 |
| α-helix | 88-90 | 3 | |
| β-strand | 92-100 | 9 | 2 |
| β-strand | 101 | 1 | 3 |
| β-strand | 110-114 | 5 | 2 |
| β-strand | 118-122 | 5 | 2 |
| α-helix | 125-127 | 3 | |
| β-strand | 128 | 1 | 4 |
| α-helix | 129-130 | 2 | |
| β-strand | 131-135 | 5 | 5 |
| α-helix | 136-138 | 3 | |
| β-strand | 146-156 | 11 | 5 |
| β-strand | 157 | 1 | 4 |
| β-strand | 162-165 | 4 | 6 |
| α-helix | 166-168 | 3 | |
| β-strand | 170 | 1 | 6 |
| β-strand | 174-176 | 3 | 5 |
| α-helix | 177-179 | 3 | |
| β-strand | 180-181 | 2 | 5 |
| β-strand | 187-196 | 10 | 5 |
| α-helix | 197-201 | 5 | |
| β-strand | 206-211 | 6 | 6 |
| α-helix | 212-214 | 3 | |
| β-strand | 216-221 | 6 | 6 |
Chain L: 8 helices, 21 β-strands
| Element | Residues | Length | Sheet |
|---|
| β-strand | 4-7 | 4 | 7 |
| β-strand | 10-14 | 5 | 8 |
| β-strand | 19-25 | 7 | 7 |
| β-strand | 33-38 | 6 | 8 |
| β-strand | 45-49 | 5 | 8 |
| β-strand | 53-54 | 2 | 8 |
| α-helix | 55 | 1 | |
| β-strand | 62-67 | 6 | 7 |
| β-strand | 70-75 | 6 | 7 |
| α-helix | 80-82 | 3 | |
| β-strand | 84-90 | 7 | 8 |
| β-strand | 99 | 1 | 8 |
| β-strand | 103-108 | 6 | 8 |
| β-strand | 112 | 1 | 9 |
| α-helix | 113-114 | 2 | |
| β-strand | 115-119 | 5 | 10 |
| α-helix | 120-122 | 3 | |
| α-helix | 123-126 | 4 | |
| β-strand | 130-140 | 11 | 10 |
| β-strand | 141 | 1 | 9 |
| β-strand | 146-151 | 6 | 11 |
| β-strand | 154-155 | 2 | 11 |
| α-helix | 156 | 1 | |
| β-strand | 160-164 | 5 | 10 |
| α-helix | 165-168 | 4 | |
| β-strand | 174-183 | 10 | 10 |
| α-helix | 184-188 | 5 | |
| β-strand | 192-198 | 7 | 11 |
| β-strand | 206-211 | 6 | 11 |
Molecules and chains
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|
| Fab389 heavy chain | A, H | protein | 227 | Homo sapiens | |
| Fab389 light chain | D, L | protein | 215 | Homo sapiens | |
| Circumsporozoite protein | B, C | protein | 73 | Plasmodium falciparum 3D7 | Q7K740 (AlphaFold model) |
Sequence of entity 1 (A, H), FASTA
>9NI1_1 Fab389 heavy chain (chains A, H)
EVQLVESGGGLVQPGGSLRLSCAGSGFTFTYYGMNWIRQAPGKGLEWVSYISVGSDIIHY
ADSVKGRFSISRDNAKKSLYLQMNSLRVEDSAVYFCVRGVSSGHYGTEDLLDYWGQGTLV
TVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAV
LQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSC
Sequence of entity 2 (D, L), FASTA
>9NI1_2 Fab389 light chain (chains D, L)
DIQMTQSPSTLSASVGDRVTITCRASQSISTWLAWYQQRPGKAPKLLIYKASSLETGVPS
RFSGSGSGTEFTLTISSLQPDDFATYYCHQYSSYSPRSFGQGTKLEIKRTVAAPSVFIFP
PSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTL
TLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC
Sequence of entity 3 (B, C), FASTA
>9NI1_3 Circumsporozoite protein (chains B, C)
EPSDKHIKEYLNKIQNSLSTEWSPCSVTCGNGIQVRIKPGSANKPKDELDYANDIEKKIC
KMEKCSSHHHHHH
Primary citation
Fab389 in complex with the C-terminal alpha-TSR domain of the P. falciparum circumsporozoite protein. Moskovitz, R., Wilson, I.A. To be published.
Other PDB entries of the same protein (UniProt Q7K740 (AlphaFold model), which also has an AlphaFold model), best resolution first:
- 7SG5 1.4 Å, Structure of PfCSP peptide 21 with antibody CIS43_Var2
- 9C79 1.46 Å, Human monoclonal antibody MAD21-101 bound to the N-terminus of cleaved circumsporozoite…
- 9NKZ 1.48 Å, Crystal structure of Fab MAM01 in complex with NANP6 peptide from circumsporozoite protein
- 9NL0 1.54 Å, Crystal structure of Fab MAM01 in complex with NPNA3 peptide from circumsporozoite protein
- 7SG6 1.55 Å, Structure of PfCSP peptide 21 with antibody CIS43_Var10
- 6PBV 1.57 Å, Crystal structure of Fab668 complex
- 9NCY 1.63 Å, Fab1392 in complex with the C-terminal alpha-TSR domain of the P. falciparum…
- 3VDJ 1.7 Å, Crystal structure of circumsporozoite protein aTSR domain, R32 native form
- 9DST 1.74 Å, Crystal structure of Fab MS-1805 in complex with N-terminal junction peptide from…
- 7RXP 1.76 Å, Fab1512 in complex with the C-terminal alpha-TSR domain of P. falciparum
- 6BQB 1.77 Å, MGG4 Fab in complex with peptide
- 7LKB 1.8 Å, Crystal structure of PfCSP peptide 21 with vaccine-elicited human anti-malaria antibody…
Browse structure collections
About this viewer
MolViewer shows 9NI1 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.