SARS-CoV-2 3CLPro in complex with 8-(2,5-dihydro-1H-pyrrol-3-yl)-2-hydroxy-3-(4-isoquinolyl)-6-(trifluoromethyl)-1H-quinolin-4-one. Determined by X-ray diffraction at 2.0 Å resolution. Released 18 Mar 2026.
Explore 9NMG in 3D Show helices and sheets RCSB PDB PDBe
9NMG contains 32 α-helices and 40 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 7 | 1 | 1 |
| α-helix | 8-9 | 2 | |
| α-helix | 11-14 | 4 | |
| β-strand | 17-22 | 6 | 2 |
| β-strand | 25-32 | 8 | 2 |
| β-strand | 35-39 | 5 | 2 |
| α-helix | 40-43 | 4 | |
| α-helix | 54-59 | 6 | |
| α-helix | 63-65 | 3 | |
| β-strand | 66-70 | 5 | 2 |
| β-strand | 73-75 | 3 | 2 |
| α-helix | 76 | 1 | |
| β-strand | 77-83 | 7 | 2 |
| β-strand | 86-91 | 6 | 2 |
| α-helix | 98-99 | 2 | |
| β-strand | 100-103 | 4 | 3 |
| α-helix | 105-107 | 3 | |
| β-strand | 111-118 | 8 | 3 |
| β-strand | 121-129 | 9 | 3 |
| β-strand | 136 | 1 | 3 |
| β-strand | 148-153 | 6 | 3 |
| β-strand | 156-166 | 11 | 3 |
| β-strand | 172-175 | 4 | 3 |
| α-helix | 180 | 1 | |
| β-strand | 181 | 1 | 3 |
| α-helix | 194-197 | 4 | |
| β-strand | 199 | 1 | 4 |
| α-helix | 201-213 | 13 | |
| α-helix | 227-235 | 9 | |
| β-strand | 239 | 1 | 4 |
| α-helix | 240-241 | 2 | |
| α-helix | 244-249 | 6 | |
| α-helix | 251-257 | 7 | |
| α-helix | 261-274 | 14 | |
| β-strand | 281 | 1 | 5 |
| β-strand | 284 | 1 | 5 |
| α-helix | 293-300 | 8 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 7 | 1 | 3 |
| α-helix | 8-9 | 2 | |
| α-helix | 11-14 | 4 | |
| β-strand | 17-22 | 6 | 6 |
| β-strand | 25-32 | 8 | 6 |
| β-strand | 35-39 | 5 | 6 |
| α-helix | 40-43 | 4 | |
| α-helix | 54-59 | 6 | |
| α-helix | 63-65 | 3 | |
| β-strand | 66-70 | 5 | 6 |
| β-strand | 73-75 | 3 | 6 |
| α-helix | 76 | 1 | |
| β-strand | 77-83 | 7 | 6 |
| β-strand | 86-91 | 6 | 6 |
| α-helix | 98-99 | 2 | |
| β-strand | 101-103 | 3 | 1 |
| α-helix | 105-107 | 3 | |
| β-strand | 111-118 | 8 | 1 |
| β-strand | 121-129 | 9 | 1 |
| β-strand | 136 | 1 | 1 |
| β-strand | 148-153 | 6 | 1 |
| β-strand | 156-166 | 11 | 1 |
| β-strand | 172-175 | 4 | 1 |
| α-helix | 180 | 1 | |
| β-strand | 181 | 1 | 1 |
| β-strand | 199 | 1 | 7 |
| α-helix | 201-213 | 13 | |
| α-helix | 227-236 | 10 | |
| β-strand | 239 | 1 | 7 |
| α-helix | 240-242 | 3 | |
| α-helix | 244-256 | 13 | |
| α-helix | 261-274 | 14 | |
| β-strand | 281 | 1 | 8 |
| β-strand | 284 | 1 | 8 |
| α-helix | 293-301 | 9 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Glutathione S-transferase class-mu 26 kDa isozyme,Replicase polyprotein 1ab | A, B | protein | 549 | Severe acute respiratory syndrome coronavirus 2 | P08515 (AlphaFold model), P0DTD1 (AlphaFold model) |
>9NMG_1 Glutathione S-transferase class-mu 26 kDa isozyme,Replicase polyprotein 1ab (chains A, B) MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYID GDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKV DFLSKLPEMLKMFEDRLCHKTYLNGDHVTHPDFMLYDALDVVLYMDPMCLDAFPKLVCFK KRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHPPKSDLEVLFQGPLGSAVLQSGFRK MAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIRKSNHN FLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNGSPSGV YQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGNFYGPF VDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLTQD HVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQCSGVTF QGPHHHHHH
| ID | Name | Formula | Copies |
|---|---|---|---|
| A1BY5 | (3P,8P)-8-(2,5-dihydro-1H-pyrrol-3-yl)-2-hydroxy-3-(isoquinolin-4-yl)-6-(triflu… | C23 H16 F3 N3 O2 | 2 |
Structure Based Design of non-covalent, non-peptidic inhibitors of SARS-CoV-2 Main Protease. Goins, C.M., Stauffer, S.R., Rodzinak, K. To be published.
Other PDB entries of the same protein (UniProt P08515 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 9NMG directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.